PDB entry 6hd4

View 6hd4 on RCSB PDB site
Description: abl1 in complex with compound 7 and imatinib (sti-571)
Class: transferase
Keywords: PHOSPHOTRANSFERASE, Inhibitor complex, TRANSFERASE
Deposited on 2018-08-17, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ABL1
    Species: Mus musculus [TaxId:10090]
    Gene: Abl1, Abl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00520 (6-End)
      • expression tag (0-5)
    Domains in SCOPe 2.07: d6hd4a1, d6hd4a2
  • Chain 'B':
    Compound: Tyrosine-protein kinase ABL1
    Species: Mus musculus [TaxId:10090]
    Gene: Abl1, Abl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00520 (6-End)
      • expression tag (2-5)
    Domains in SCOPe 2.07: d6hd4b1, d6hd4b2
  • Heterogens: GOL, CL, FYW, STI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hd4A (A:)
    gamdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmevee
    flkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvlly
    matqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfp
    ikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpe
    gcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hd4A (A:)
    gamdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedmeveef
    lkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllym
    atqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpi
    kwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpeg
    cpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hd4B (B:)
    gamdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmevee
    flkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvlly
    matqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfp
    ikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpe
    gcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hd4B (B:)
    mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkmeveeflkea
    avmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqi
    ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
    peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
    vyelmracwqwnpsdrpsfaeihqafetmfqessisdevekel