PDB entry 6hcp

View 6hcp on RCSB PDB site
Description: Crystal structure of BauA, the Ferric preacinetobactin receptor from Acinetobacter baumannii
Class: membrane protein
Keywords: BauA, outer-membrane transporter, MEMBRANE PROTEIN
Deposited on 2018-08-16, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BauA
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: bauA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hcpa_
  • Chain 'B':
    Compound: BauA
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: bauA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hcpb_
  • Chain 'C':
    Compound: BauA
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: bauA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hcpc_
  • Heterogens: EDO, C8E, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hcpA (A:)
    gamavidnstktleqqtaqtnvaalpaitvkaeqddtyaggqvatssnvgflgskkfldt
    pfntisytdkyiedkqakditeviaatdpsiytngasggwsenyyirgyasstndmsmng
    lfgitpfyrtspemfgrvevlkgpsallngmppagsvggtvnlvtkyaadepfarlttty
    msdaqfgghvdvgrrfgenkefgvringmyrdgdaavndqskesrlfslgldwqgenarv
    fvdaydaldhvdgvtrgvnvstavgipkppkadtllspdwgsvetkdkgamirgeydfsd
    qlmayaaygqstteykyngasagtitsstgtlsstlgqlafdvdkksadagfkgkfetgs
    vkhqwvanatyynhtqddygyriipgfsdpvitniydpnpnwgpkpeftppflfhstlst
    ssfgladtlsfaqdkvqltlglrhqtvkatssvntlpenaksattpgvallikatdkisv
    yanyiegltkgdqapatasnpgeifppqktkqqelglkvdlgtfahtlsafeitkpssyl
    dpsklvnnlptfvsdgeqrnrgiewsffgspiehvrlmggftyldpeltktksggndght
    avavpknqaklgaewdtqvaqgtltlsgninavskqyinaentlsvpgrtlldvgaryst
    kvedhpvtfraniynltnkaywaqpqltnlalgaprtymlsvsydf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hcpA (A:)
    dtyaggqvatssnvgflgskkfldtpfntisytdkyiedkqakditeviaatdpsiytng
    asggwsenyyirgyasstndmsmnglfgitpfyrtspemfgrvevlkgpsallngmppag
    svggtvnlvtkyaadepfarltttymsdaqfgghvdvgrrfgenkefgvringmyrdgda
    avndqskesrlfslgldwqgenarvfvdaydaldhvdgvtrgvnvstavgipkppkadtl
    lspdwgsvetkdkgamirgeydfsdqlmayaaygqstteykyngasagtitsstgtlsst
    lgqlafdvdkksadagfkgkfetgsvkhqwvanatyynhtqddygyriipgfsdpvitni
    ydpnpnwgpkpeftppflfhstlstssfgladtlsfaqdkvqltlglrhqtvkatssvnt
    lpenaksattpgvallikatdkisvyanyiegltkgdqapatasnpgeifppqktkqqel
    glkvdlgtfahtlsafeitkpssyldpsklvnnlptfvsdgeqrnrgiewsffgspiehv
    rlmggftyldpeltktksggndghtavavpknqaklgaewdtqvaqgtltlsgninavsk
    qyinaentlsvpgrtlldvgarystkvedhpvtfraniynltnkaywaqpqltnlalgap
    rtymlsvsydf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hcpB (B:)
    gamavidnstktleqqtaqtnvaalpaitvkaeqddtyaggqvatssnvgflgskkfldt
    pfntisytdkyiedkqakditeviaatdpsiytngasggwsenyyirgyasstndmsmng
    lfgitpfyrtspemfgrvevlkgpsallngmppagsvggtvnlvtkyaadepfarlttty
    msdaqfgghvdvgrrfgenkefgvringmyrdgdaavndqskesrlfslgldwqgenarv
    fvdaydaldhvdgvtrgvnvstavgipkppkadtllspdwgsvetkdkgamirgeydfsd
    qlmayaaygqstteykyngasagtitsstgtlsstlgqlafdvdkksadagfkgkfetgs
    vkhqwvanatyynhtqddygyriipgfsdpvitniydpnpnwgpkpeftppflfhstlst
    ssfgladtlsfaqdkvqltlglrhqtvkatssvntlpenaksattpgvallikatdkisv
    yanyiegltkgdqapatasnpgeifppqktkqqelglkvdlgtfahtlsafeitkpssyl
    dpsklvnnlptfvsdgeqrnrgiewsffgspiehvrlmggftyldpeltktksggndght
    avavpknqaklgaewdtqvaqgtltlsgninavskqyinaentlsvpgrtlldvgaryst
    kvedhpvtfraniynltnkaywaqpqltnlalgaprtymlsvsydf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hcpB (B:)
    dtyaggqvatssnvgflgskkfldtpfntisytdkyiedkqakditeviaatdpsiytng
    asggwsenyyirgyasstndmsmnglfgitpfyrtspemfgrvevlkgpsallngmppag
    svggtvnlvtkyaadepfarltttymsdaqfgghvdvgrrfgenkefgvringmyrdgda
    avndqskesrlfslgldwqgenarvfvdaydaldhvdgvtrgvnvstavgipkppkadtl
    lspdwgsvetkdkgamirgeydfsdqlmayaaygqstteykyngasagtitsstgtlsst
    lgqlafdvdkksadagfkgkfetgsvkhqwvanatyynhtqddygyriipgfsdpvitni
    ydpnpnwgpkpeftppflfhstlstssfgladtlsfaqdkvqltlglrhqtvkatssvnt
    lpenaksattpgvallikatdkisvyanyiegltkgdqapatasnpgeifppqktkqqel
    glkvdlgtfahtlsafeitkpssyldpsklvnnlptfvsdgeqrnrgiewsffgspiehv
    rlmggftyldpeltktksggndghtavavpknqaklgaewdtqvaqgtltlsgninavsk
    qyinaentlsvpgrtlldvgarystkvedhpvtfraniynltnkaywaqpqltnlalgap
    rtymlsvsydf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6hcpC (C:)
    gamavidnstktleqqtaqtnvaalpaitvkaeqddtyaggqvatssnvgflgskkfldt
    pfntisytdkyiedkqakditeviaatdpsiytngasggwsenyyirgyasstndmsmng
    lfgitpfyrtspemfgrvevlkgpsallngmppagsvggtvnlvtkyaadepfarlttty
    msdaqfgghvdvgrrfgenkefgvringmyrdgdaavndqskesrlfslgldwqgenarv
    fvdaydaldhvdgvtrgvnvstavgipkppkadtllspdwgsvetkdkgamirgeydfsd
    qlmayaaygqstteykyngasagtitsstgtlsstlgqlafdvdkksadagfkgkfetgs
    vkhqwvanatyynhtqddygyriipgfsdpvitniydpnpnwgpkpeftppflfhstlst
    ssfgladtlsfaqdkvqltlglrhqtvkatssvntlpenaksattpgvallikatdkisv
    yanyiegltkgdqapatasnpgeifppqktkqqelglkvdlgtfahtlsafeitkpssyl
    dpsklvnnlptfvsdgeqrnrgiewsffgspiehvrlmggftyldpeltktksggndght
    avavpknqaklgaewdtqvaqgtltlsgninavskqyinaentlsvpgrtlldvgaryst
    kvedhpvtfraniynltnkaywaqpqltnlalgaprtymlsvsydf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hcpC (C:)
    dtyaggqvatssnvgflgskkfldtpfntisytdkyiedkqakditeviaatdpsiytng
    asggwsenyyirgyasstndmsmnglfgitpfyrtspemfgrvevlkgpsallngmppag
    svggtvnlvtkyaadepfarltttymsdaqfgghvdvgrrfgenkefgvringmyrdgda
    avndqskesrlfslgldwqgenarvfvdaydaldhvdgvtrgvnvstavgipkppkadtl
    lspdwgsvetkdkgamirgeydfsdqlmayaaygqstteykyngasagtitsstgtlsst
    lgqlafdvdkksadagfkgkfetgsvkhqwvanatyynhtqddygyriipgfsdpvitni
    ydpnpnwgpkpeftppflfhstlstssfgladtlsfaqdkvqltlglrhqtvkatssvnt
    lpenaksattpgvallikatdkisvyanyiegltkgdqapatasnpgeifppqktkqqel
    glkvdlgtfahtlsafeitkpssyldpsklvnnlptfvsdgeqrnrgiewsffgspiehv
    rlmggftyldpeltktksggndghtavavpknqaklgaewdtqvaqgtltlsgninavsk
    qyinaentlsvpgrtlldvgarystkvedhpvtfraniynltnkaywaqpqltnlalgap
    rtymlsvsydf