PDB entry 6hbc

View 6hbc on RCSB PDB site
Description: Structure of the repeat unit in the network formed by CcmM and Rubisco from Synechococcus elongatus
Class: protein binding
Keywords: CcmM, M58, M35, SSUL domain, Rubisco, Carboxysome, PROTEIN BINDING
Deposited on 2018-08-10, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: EM
Resolution: 2.78 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbon dioxide concentrating mechanism protein CcmM
    Species: Synechococcus elongatus (strain PCC 7942) [TaxId:1140]
    Gene: ccmM, Synpcc7942_1423
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Synechococcus elongatus (strain PCC 7942) [TaxId:1140]
    Gene: cbbL, rbcL, Synpcc7942_1426
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hbcb1, d6hbcb2
  • Chain 'C':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Synechococcus elongatus (strain PCC 7942) [TaxId:1140]
    Gene: cbbL, rbcL, Synpcc7942_1426
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hbcc1, d6hbcc2
  • Chain 'D':
    Compound: Ribulose 1,5-bisphosphate carboxylase small subunit
    Species: Synechococcus elongatus (strain PCC 7942) [TaxId:1140]
    Gene: Synpcc7942_1427
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hbcd_
  • Chain 'E':
    Compound: Ribulose 1,5-bisphosphate carboxylase small subunit
    Species: Synechococcus elongatus (strain PCC 7942) [TaxId:1140]
    Gene: Synpcc7942_1427
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hbce_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hbcB (B:)
    mpktqsaagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesst
    gtwttvwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgn
    vfgfkairslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsak
    nygravyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvt
    aptceemmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidr
    qrnhgihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvf
    ftqdwasmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrva
    leacvqarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hbcB (B:)
    ykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwttvwtdlltdmdr
    ykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgnvfgfkairslrledir
    fpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsaknygravyeclrggldf
    tkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvtaptceemmkraefake
    lgmpiimhdfltagftanttlakwcrdngvllhihramhavidrqrnhgihfrvlakclr
    lsggdhlhsgtvdkastlgfvdlmredhieadrsrgvfftqdwasmpgvlpvasggihvw
    hmpalveifgddsvlqfgggtlghpwgnapgatanrvaleacvqarnegrdlyreggdil
    reagkwspelaaaldlwkei
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6hbcC (C:)
    mpktqsaagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesst
    gtwttvwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgn
    vfgfkairslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsak
    nygravyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvt
    aptceemmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidr
    qrnhgihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvf
    ftqdwasmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrva
    leacvqarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hbcC (C:)
    ykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwttvwtdlltdmdr
    ykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgnvfgfkairslrledir
    fpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsaknygravyeclrggldf
    tkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvtaptceemmkraefake
    lgmpiimhdfltagftanttlakwcrdngvllhihramhavidrqrnhgihfrvlakclr
    lsggdhlhsgtvdkastlgfvdlmredhieadrsrgvfftqdwasmpgvlpvasggihvw
    hmpalveifgddsvlqfgggtlghpwgnapgatanrvaleacvqarnegrdlyreggdil
    reagkwspelaaaldlwkei
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6hbcD (D:)
    msmktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwkl
    plfdckspqqvldevrecrseygdcyirvagfdnikqcqtvsfivhrpgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hbcD (D:)
    mktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklpl
    fdckspqqvldevrecrseygdcyirvagfdnikqcqtvsfivhrp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6hbcE (E:)
    msmktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwkl
    plfdckspqqvldevrecrseygdcyirvagfdnikqcqtvsfivhrpgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hbcE (E:)
    mktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklpl
    fdckspqqvldevrecrseygdcyirvagfdnikqcqtvsfivhrp