PDB entry 6hay

View 6hay on RCSB PDB site
Description: Crystal structure of PROTAC 1 in complex with the bromodomain of human SMARCA2 and pVHL:ElonginC:ElonginB
Class: gene regulation
Keywords: bromodomain, E3 Ubiquitin Protein Ligase, GENE REGULATION
Deposited on 2018-08-09, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable global transcription activator SNF2L2
    Species: Homo sapiens [TaxId:9606]
    Gene: SMARCA2, BAF190B, BRM, SNF2A, SNF2L2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6haya_
  • Chain 'B':
    Compound: von hippel-lindau disease tumor suppressor
    Species: Homo sapiens [TaxId:9606]
    Gene: VHL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hayb_
  • Chain 'C':
    Compound: Elongin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOC, TCEB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15369 (1-96)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6hayc1, d6hayc2
  • Chain 'D':
    Compound: Elongin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOB, TCEB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hayd_
  • Chain 'E':
    Compound: Probable global transcription activator SNF2L2
    Species: Homo sapiens [TaxId:9606]
    Gene: SMARCA2, BAF190B, BRM, SNF2A, SNF2L2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6haye_
  • Chain 'F':
    Compound: von hippel-lindau disease tumor suppressor
    Species: Homo sapiens [TaxId:9606]
    Gene: VHL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hayf_
  • Chain 'G':
    Compound: Elongin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOC, TCEB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15369 (1-96)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6hayg1, d6hayg2
  • Chain 'H':
    Compound: Elongin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOB, TCEB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hayh_
  • Heterogens: FX8, EDO, FMT, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hayA (A:)
    smaeklspnppkltkqmnaiidtvinykdssgrqlsevfiqlpsrkelpeyyelirkpvd
    fkkikerirnhkyrslgdlekdvmllchnaqtfnlegsqiyedsivlqsvfksarqkiak
    eee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hayA (A:)
    eklspnppkltkqmnaiidtvinykdssgrqlsevfiqlpsrkelpeyyelirkpvdfkk
    ikerirnhkyrslgdlekdvmllchnaqtfnlegsqiyedsivlqsvfksarqkiakeee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hayB (B:)
    gsmeagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihs
    yrghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvk
    penyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hayB (B:)
    prpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwl
    frdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrl
    divrslyedledhpnvqkdlerltqeriahqr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hayC (C:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hayD (D:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6hayE (E:)
    smaeklspnppkltkqmnaiidtvinykdssgrqlsevfiqlpsrkelpeyyelirkpvd
    fkkikerirnhkyrslgdlekdvmllchnaqtfnlegsqiyedsivlqsvfksarqkiak
    eee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hayE (E:)
    spnppkltkqmnaiidtvinykdssgrqlsevfiqlpsrkelpeyyelirkpvdfkkike
    rirnhkyrslgdlekdvmllchnaqtfnlegsqiyedsivlqsvfksarqkiake
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6hayF (F:)
    gsmeagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihs
    yrghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvk
    penyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hayF (F:)
    prpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwl
    frdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrl
    divrslyedledhpnvqkdlerltqeriahq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6hayG (G:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hayG (G:)
    mmyvklissdghefivkrehaltsgtikamlstnevnfreipshvlskvcmyftykvryt
    nssteipefpiapeialellmaanfldc
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6hayH (H:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hayH (H:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvm