PDB entry 6haf

View 6haf on RCSB PDB site
Description: Pyruvate oxidase variant E59Q from L. plantarum in complex with phosphate
Class: oxidoreductase
Keywords: carbanion, structure activity relationship, oxidation-reduction, umpolung, thiamine diphosphate, reaction intermediate, flavin adenine dinucleotide, oxidoreductase
Deposited on 2018-08-07, released 2019-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate oxidase
    Species: Lactobacillus plantarum [TaxId:1590]
    Gene: spxB, C4O30_12890, CUR48_03890
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hafa1, d6hafa2, d6hafa3
  • Chain 'B':
    Compound: Pyruvate oxidase
    Species: Lactobacillus plantarum [TaxId:1590]
    Gene: spxB, C4O30_12890, CUR48_03890
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hafb1, d6hafb2, d6hafb3
  • Heterogens: TDP, FAD, K, MG, GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hafA (A:)
    mvmkqtkqtnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrhqe
    vgamaaaadakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdt
    fqemnenpiyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipae
    dwyasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkip
    lmstypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntr
    yflqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwrayl
    asledkqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfa
    tmgvgipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfi
    kdeqedtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvli
    davitgdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfglddlqhqigq
    ggf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hafA (A:)
    tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrhqevgamaaaa
    dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
    iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedwyasans
    yqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplmstypak
    givadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryflqidid
    paklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylasledkqe
    gplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvgipg
    aiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfikdeqedtn
    qndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavitgdr
    plpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hafB (B:)
    mvmkqtkqtnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrhqe
    vgamaaaadakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdt
    fqemnenpiyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipae
    dwyasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkip
    lmstypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntr
    yflqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwrayl
    asledkqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfa
    tmgvgipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfi
    kdeqedtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvli
    davitgdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfglddlqhqigq
    ggf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hafB (B:)
    tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrhqevgamaaaa
    dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
    iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedwyasans
    yqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplmstypak
    givadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryflqidid
    paklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylasledkqe
    gplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvgipg
    aiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfikdeqedtn
    qndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavitgdr
    plpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd