PDB entry 6h9w

View 6h9w on RCSB PDB site
Description: Unraveling the role of the secretor antigen in human rotavirus attachment to histo-blood group antigens
Class: viral protein
Keywords: histo-blood group antigen rotavirus, VIRAL PROTEIN
Deposited on 2018-08-06, released 2019-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Gene: VP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6h9wa_
  • Heterogens: SO4, CIT, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6h9wA (A:)
gsmldgpyqpttftppsdywilinsntngvvyestnnsdfwtaviavephvdpvdrqynv
fgenkqfnvrndsdkwkflemfrgssqndfynrrtltsntrlvgilkyggriwtfhgetp
rattdssntanlngisitihsefyiiprsqeskcneyinngl

    Sequence, based on observed residues (ATOM records): (download) 
    >6h9wA (A:)
ldgpyqpttftppsdywilinsntngvvyestnnsdfwtaviavephvdpvdrqynvfge
nkqfnvrndsdkwkflemfrgssqndfynrrtltsntrlvgilkyggriwtfhgetprat
tdssntanlngisitihsefyiiprsqeskcneyinngl