PDB entry 6h9s

View 6h9s on RCSB PDB site
Description: Crystal dimeric structure of Petrotoga mobilis lactate dehydrogenase with NADH
Class: oxidoreductase
Keywords: Petrotoga mobilis, Lactate dehydrogenase, NADH, OXIDOREDUCTASE
Deposited on 2018-08-06, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Petrotoga mobilis (strain DSM 10674 / SJ95) [TaxId:403833]
    Gene: ldh, Pmob_1893
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h9sa1, d6h9sa2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Petrotoga mobilis (strain DSM 10674 / SJ95) [TaxId:403833]
    Gene: ldh, Pmob_1893
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h9sb1, d6h9sb2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h9sA (A:)
    mkisiigtgrvgsstafalinaavadeivlydlnkemaegealdllhattfhkrmiirag
    eysdiegsdivlitagaaqkpgetrldltiknakiikgisenikkyapntliinitnpvd
    vmsyvvwkvtgfesnrvigtgtildtarlraligkncgvspmsvhayiigehgdselaaw
    ssamiggvpikgfcrncpykdncnkdlskifddvknsaytiiskkgatnygiasattalv
    esiiknegrvytpsvllddvyigypavinkdgvertiditlndeetekfessksiikeyl
    esiknll
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h9sA (A:)
    mkisiigtgrvgsstafalinaavadeivlydlnkemaegealdllhattfhkrmiirag
    eysdiegsdivlitagaatrldltiknakiikgisenikkyapntliinitnpvdvmsyv
    vwkvtgfesnrvigtgtildtarlraligkncgvspmsvhayiigehgdselaawssami
    ggvpikgfcdlskifddvknsaytiiskkgatnygiasattalvesiiknegrvytpsvl
    lddvyigypavinkdgvertiditlndeetekfessksiikeylesikn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6h9sB (B:)
    mkisiigtgrvgsstafalinaavadeivlydlnkemaegealdllhattfhkrmiirag
    eysdiegsdivlitagaaqkpgetrldltiknakiikgisenikkyapntliinitnpvd
    vmsyvvwkvtgfesnrvigtgtildtarlraligkncgvspmsvhayiigehgdselaaw
    ssamiggvpikgfcrncpykdncnkdlskifddvknsaytiiskkgatnygiasattalv
    esiiknegrvytpsvllddvyigypavinkdgvertiditlndeetekfessksiikeyl
    esiknll
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h9sB (B:)
    mkisiigtgrvgsstafalinaavadeivlydlnkemaegealdllhattfhkrmiirag
    eysdiegsdivlitagaaetrldltiknakiikgisenikkyapntliinitnpvdvmsy
    vvwkvtgfesnrvigtgtildtarlraligkncgvspmsvhayiigehgdselaawssam
    iggvpikgfcdlskifddvknsaytiiskkgatnygiasattalvesiiknegrvytpsv
    llddvyigypavinkdgvertiditlndeetekfessksiikeylesiknll