PDB entry 6h8r

View 6h8r on RCSB PDB site
Description: crystal structure of the human protein tyrosine phosphatase ptpn5 (step) in complex with compound 2
Class: hydrolase
Keywords: protein phosphatase, ptn5, step, allosteric modulator, hydrolase
Deposited on 2018-08-03, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 5
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54829 (23-End)
      • expression tag (16-22)
    Domains in SCOPe 2.07: d6h8ra1, d6h8ra2
  • Heterogens: FWB, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h8rA (A:)
    mhhhhhhssgvdlgtenlyfqsmsrvlqaeelhekaldpfllqaeffeipmnfvdpkeyd
    ipglvrknryktilpnphsrvcltspdpddplssyinanyirgyggeekvyiatqgpivs
    tvadfwrmvwqehtpiivmitnieemnekcteywpeeqvaydgveitvqkvihtedyrlr
    lislksgteerglkhywftswpdqktpdrappllhlvreveeaaqqegphcapiivhcsa
    gigrtgcfiatsiccqqlrqegvvdilkttcqlrqdrggmiqtceqyqfvhhvmslyekq
    lshqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h8rA (A:)
    nlyfqsmsrvlqaeelhekaldpfllqaeffeipmnfvdpkeydipglvrknryktilpn
    phsrvcltspdpddplssyinanyirgyggeekvyiatqgpivstvadfwrmvwqehtpi
    ivmitnieemnekcteywpeeqvaydgveitvqkvihtedyrlrlislksgteerglkhy
    wftswpdqktpdrappllhlvreveeaaqqegphcapiivhcsagigrtgcfiatsiccq
    qlrqegvvdilkttcqlrqdrggmiqtceqyqfvhhvmslyekqlshq