PDB entry 6h7v

View 6h7v on RCSB PDB site
Description: Crystal structure of BauA, the Ferric preacinetobactin receptor from Acinetobacter baumannii
Class: membrane protein
Keywords: BauA, outer-membrane transporter, MEMBRANE PROTEIN
Deposited on 2018-07-31, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ligand-gated channel protein
    Species: Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / CIP 70.34 / JCM 6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) [TaxId:575584]
    Gene: BIT33_06105, HMPREF0010_02301
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0CC21 (Start-705)
      • conflict (379)
    Domains in SCOPe 2.07: d6h7va_
  • Chain 'B':
    Compound: Ligand-gated channel protein
    Species: Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / CIP 70.34 / JCM 6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) [TaxId:575584]
    Gene: BIT33_06105, HMPREF0010_02301
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0CC21 (Start-705)
      • conflict (379)
    Domains in SCOPe 2.07: d6h7vb_
  • Chain 'C':
    Compound: Ligand-gated channel protein
    Species: Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / CIP 70.34 / JCM 6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) [TaxId:575584]
    Gene: BIT33_06105, HMPREF0010_02301
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0CC21 (Start-705)
      • conflict (379)
    Domains in SCOPe 2.07: d6h7vc_
  • Heterogens: EDO, C8E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h7vA (A:)
    gamavidnstktleqqtaqtnvaalpaitvkaeqddtyaggqvatssnvgflgskkfldt
    pfntisytdkyiedkqakditeviaatdpsiytngasggwsenyyirgyasstndmsmng
    lfgitpfyrtspemfgrvevlkgpsallngmppagsvggtvnlvtkyaadepfarlttty
    msdaqfgghvdvgrrfgenkefgvringmyrdgdaavndqskesrlfslgldwqgenarv
    fvdaydaldhvdgvtrgvnvstavgipkppkadtllspdwgsvetkdkgamirgeydfsd
    qlmayaaygqstteykyngasagtitsstgtlsstlgqlafdvdkksadagfkgkfetgs
    vkhqwvanatyynhtqddysyriipgfsdpvitniydpnpnwgpkpeftppflfhstlst
    ssfgladtlsfaqdkvqltlglrhqtvkatssvntlpenaksattpgvallikatdkisv
    yanyiegltkgdqapatasnpgeifppqktkqqelglkvdlgtfahtlsafeitkpssyl
    dpsklvnnlptfvsdgeqrnrgiewsffgspiehvrlmggftyldpeltktksggndght
    avavpknqaklgaewdtqvaqgtltlsgninavskqyinaentlsvpgrtlldvgaryst
    kvedhpvtfraniynltnkaywaqpqltnlalgaprtymlsvsydf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h7vA (A:)
    ddtyaggqvatssnvgflgskkfldtpfntisytdkyiedkqakditeviaatdpsiytn
    gasggwsenyyirgyasstndmsmnglfgitpfyrtspemfgrvevlkgpsallngmppa
    gsvggtvnlvtkyaadepfarltttymsdaqfgghvdvgrrfgenkefgvringmyrdgd
    aavndqskesrlfslgldwqgenarvfvdaydaldhvdgvtrgvnvstavgipkppkadt
    llspdwgsvetkdkgamirgeydfsdqlmayaaygqstteykyngasagtitsstgtlss
    tlgqlafdvdkksadagfkgkfetgsvkhqwvanatyynhtqddysyriipgfsdpvitn
    iydpnpnwgpkpeftppflfhstlstssfgladtlsfaqdkvqltlglrhqtvkatssvn
    tlpenaksattpgvallikatdkisvyanyiegltkgdqapatasnpgeifppqktkqqe
    lglkvdlgtfahtlsafeitkpssyldpsklvnnlptfvsdgeqrnrgiewsffgspieh
    vrlmggftyldpeltktksggndghtavavpknqaklgaewdtqvaqgtltlsgninavs
    kqyinaentlsvpgrtlldvgarystkvedhpvtfraniynltnkaywaqpqltnlalga
    prtymlsvsydf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6h7vB (B:)
    gamavidnstktleqqtaqtnvaalpaitvkaeqddtyaggqvatssnvgflgskkfldt
    pfntisytdkyiedkqakditeviaatdpsiytngasggwsenyyirgyasstndmsmng
    lfgitpfyrtspemfgrvevlkgpsallngmppagsvggtvnlvtkyaadepfarlttty
    msdaqfgghvdvgrrfgenkefgvringmyrdgdaavndqskesrlfslgldwqgenarv
    fvdaydaldhvdgvtrgvnvstavgipkppkadtllspdwgsvetkdkgamirgeydfsd
    qlmayaaygqstteykyngasagtitsstgtlsstlgqlafdvdkksadagfkgkfetgs
    vkhqwvanatyynhtqddysyriipgfsdpvitniydpnpnwgpkpeftppflfhstlst
    ssfgladtlsfaqdkvqltlglrhqtvkatssvntlpenaksattpgvallikatdkisv
    yanyiegltkgdqapatasnpgeifppqktkqqelglkvdlgtfahtlsafeitkpssyl
    dpsklvnnlptfvsdgeqrnrgiewsffgspiehvrlmggftyldpeltktksggndght
    avavpknqaklgaewdtqvaqgtltlsgninavskqyinaentlsvpgrtlldvgaryst
    kvedhpvtfraniynltnkaywaqpqltnlalgaprtymlsvsydf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h7vB (B:)
    dtyaggqvatssnvgflgskkfldtpfntisytdkyiedkqakditeviaatdpsiytng
    asggwsenyyirgyasstndmsmnglfgitpfyrtspemfgrvevlkgpsallngmppag
    svggtvnlvtkyaadepfarltttymsdaqfgghvdvgrrfgenkefgvringmyrdgda
    avndqskesrlfslgldwqgenarvfvdaydaldhvdgvtrgvnvstavgipkppkadtl
    lspdwgsvetkdkgamirgeydfsdqlmayaaygqstteykyngasagtitsstgtlsst
    lgqlafdvdkksadagfkgkfetgsvkhqwvanatyynhtqddysyriipgfsdpvitni
    ydpnpnwgpkpeftppflfhstlstssfgladtlsfaqdkvqltlglrhqtvkatssvnt
    lpenaksattpgvallikatdkisvyanyiegltkgdqapatasnpgeifppqktkqqel
    glkvdlgtfahtlsafeitkpssyldpsklvnnlptfvsdgeqrnrgiewsffgspiehv
    rlmggftyldpeltktksggndghtavavpknqaklgaewdtqvaqgtltlsgninavsk
    qyinaentlsvpgrtlldvgarystkvedhpvtfraniynltnkaywaqpqltnlalgap
    rtymlsvsydf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6h7vC (C:)
    gamavidnstktleqqtaqtnvaalpaitvkaeqddtyaggqvatssnvgflgskkfldt
    pfntisytdkyiedkqakditeviaatdpsiytngasggwsenyyirgyasstndmsmng
    lfgitpfyrtspemfgrvevlkgpsallngmppagsvggtvnlvtkyaadepfarlttty
    msdaqfgghvdvgrrfgenkefgvringmyrdgdaavndqskesrlfslgldwqgenarv
    fvdaydaldhvdgvtrgvnvstavgipkppkadtllspdwgsvetkdkgamirgeydfsd
    qlmayaaygqstteykyngasagtitsstgtlsstlgqlafdvdkksadagfkgkfetgs
    vkhqwvanatyynhtqddysyriipgfsdpvitniydpnpnwgpkpeftppflfhstlst
    ssfgladtlsfaqdkvqltlglrhqtvkatssvntlpenaksattpgvallikatdkisv
    yanyiegltkgdqapatasnpgeifppqktkqqelglkvdlgtfahtlsafeitkpssyl
    dpsklvnnlptfvsdgeqrnrgiewsffgspiehvrlmggftyldpeltktksggndght
    avavpknqaklgaewdtqvaqgtltlsgninavskqyinaentlsvpgrtlldvgaryst
    kvedhpvtfraniynltnkaywaqpqltnlalgaprtymlsvsydf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h7vC (C:)
    dtyaggqvatssnvgflgskkfldtpfntisytdkyiedkqakditeviaatdpsiytng
    asggwsenyyirgyasstndmsmnglfgitpfyrtspemfgrvevlkgpsallngmppag
    svggtvnlvtkyaadepfarltttymsdaqfgghvdvgrrfgenkefgvringmyrdgda
    avndqskesrlfslgldwqgenarvfvdaydaldhvdgvtrgvnvstavgipkppkadtl
    lspdwgsvetkdkgamirgeydfsdqlmayaaygqstteykyngasagtitsstgtlsst
    lgqlafdvdkksadagfkgkfetgsvkhqwvanatyynhtqddysyriipgfsdpvitni
    ydpnpnwgpkpeftppflfhstlstssfgladtlsfaqdkvqltlglrhqtvkatssvnt
    lpenaksattpgvallikatdkisvyanyiegltkgdqapatasnpgeifppqktkqqel
    glkvdlgtfahtlsafeitkpssyldpsklvnnlptfvsdgeqrnrgiewsffgspiehv
    rlmggftyldpeltktksggndghtavavpknqaklgaewdtqvaqgtltlsgninavsk
    qyinaentlsvpgrtlldvgarystkvedhpvtfraniynltnkaywaqpqltnlalgap
    rtymlsvsydf