PDB entry 6h7a

View 6h7a on RCSB PDB site
Description: Structure of Leishmania PABP1 (domain J).
Class: translation
Keywords: Complex Translation Initiation Leishmania, TRANSLATION
Deposited on 2018-07-31, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PABP1 domain J
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E9AFX7 (13-91)
      • expression tag (12)
    Domains in SCOPe 2.07: d6h7aa1, d6h7aa2
  • Chain 'B':
    Compound: PABP1 domain J
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h7ab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h7aA (A:)
    mhhhhhhhhhhhhlppitpqelesmspqeqraalgdrlflkvyeiapelapkitgmflem
    kpkeayellndqkrleervtealcvlkahqta
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h7aA (A:)
    hlppitpqelesmspqeqraalgdrlflkvyeiapelapkitgmflemkpkeayellndq
    krleervtealcvlkahqta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6h7aB (B:)
    mhhhhhhhhhhhhlppitpqelesmspqeqraalgdrlflkvyeiapelapkitgmflem
    kpkeayellndqkrleervtealcvlkahqta
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h7aB (B:)
    lppitpqelesmspqeqraalgdrlflkvyeiapelapkitgmflemkpkeayellndqk
    rleervtealcvlkahqta