PDB entry 6h5x

View 6h5x on RCSB PDB site
Description: Crystal structure of human Angiotensin-1 converting enzyme N-domain in complex with Omapatrilat.
Class: hydrolase
Keywords: Angiotensin-1 converting enzyme, ACE inhibitor, Omapatrilat, Vasopeptidase inhibitor, HYDROLASE
Deposited on 2018-07-25, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiotensin-converting enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: ACE, DCP, DCP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12821 (0-End)
      • conflict (8)
      • conflict (24)
      • conflict (81)
      • conflict (116)
      • conflict (288)
      • conflict (544)
      • conflict (575)
    Domains in SCOPe 2.07: d6h5xa_
  • Chain 'B':
    Compound: angiotensin-converting enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: ACE, DCP, DCP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12821 (0-End)
      • conflict (8)
      • conflict (24)
      • conflict (81)
      • conflict (116)
      • conflict (288)
      • conflict (544)
      • conflict (575)
    Domains in SCOPe 2.07: d6h5xb_
  • Heterogens: FT8, NAG, FUC, ZN, CL, XPE, PG4, EDO, BMA, MG, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h5xA (A:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvclpnktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
    lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
    yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeef
    ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
    hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
    dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
    ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
    rkvlragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwh
    pplpdnypegidlvtdeaeaskfveeydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h5xA (A:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvclpatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedftalsn
    eaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdryin
    lrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeeffts
    lelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvhhem
    ghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtesdin
    yllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrneth
    fdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagaklrkv
    lragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwhppl
    pdnypegi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6h5xB (B:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvclpnktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
    lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
    yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeef
    ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
    hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
    dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
    ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
    rkvlragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwh
    pplpdnypegidlvtdeaeaskfveeydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h5xB (B:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvcltatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedftalsn
    eaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdryin
    lrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeeffts
    lelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvhhem
    ghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtesdin
    yllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrneth
    fdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagaklrkv
    lragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwhppl
    pdnype