PDB entry 6h4l

View 6h4l on RCSB PDB site
Description: Structure of Titin M4 trigonal form
Class: structural protein
Keywords: Titin, Muscle, Sarcomere, Ig-like, STRUCTURAL PROTEIN
Deposited on 2018-07-21, released 2019-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6h4la_
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6h4lA (A:)
gpftldhapritlrmrshrvpcgqntrfilnvqskptaevkwyhngvelqesskihytnt
sgvltleildchtddsgtyravctnykgeasdyatldvtggdy

    Sequence, based on observed residues (ATOM records): (download) 
    >6h4lA (A:)
tldhapritlrmrshrvpcgqntrfilnvqskptaevkwyhngvelqesskihytntsgv
ltleildchtddsgtyravctnykgeasdyatldvt