PDB entry 6h3u

View 6h3u on RCSB PDB site
Description: Schmallenberg Virus Glycoprotein Gc Head Domain in Complex with scFv 4B6
Class: viral protein
Keywords: Envelope Glycoprotein, scFv Antibody, VIRAL PROTEIN
Deposited on 2018-07-19, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 3.17 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelopment polyprotein
    Species: Bovine Schmallenberg virus [TaxId:1318464]
    Gene: GP
    Database cross-references and differences (RAF-indexed):
    • Uniprot H2AM12 (Start-237)
      • expression tag (238-247)
  • Chain 'B':
    Compound: Envelopment polyprotein
    Species: Bovine Schmallenberg virus [TaxId:1318464]
    Gene: GP
    Database cross-references and differences (RAF-indexed):
    • Uniprot H2AM12 (Start-237)
      • expression tag (238-246)
  • Chain 'H':
    Compound: scFv 4B6 VH
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H3U (0-End)
    Domains in SCOPe 2.07: d6h3uh_
  • Chain 'I':
    Compound: scFv 4B6 VH
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H3U (0-End)
    Domains in SCOPe 2.07: d6h3ui_
  • Chain 'L':
    Compound: scFv 4B6 VL
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H3U (0-End)
    Domains in SCOPe 2.07: d6h3ul1, d6h3ul2
  • Chain 'M':
    Compound: scFv 4B6 VL
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H3U (0-End)
    Domains in SCOPe 2.07: d6h3um_
  • Heterogens: NAG, BMA, MAN, FUC

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6h3uH (H:)
    qmqlqesgpglvkpsqslsltctvtgysitsdsawnwirqfpgnklewmgyisysgstsy
    npslksrisitrdtsknqfflqlnsvttedtatyyctrwgdgyylywyfdvwgagttvtv
    ssggggsggggsggggsggggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h3uH (H:)
    qmqlqesgpglvkpsqslsltctvtgysitsdsawnwirqfpgnklewmgyisysgstsy
    npslksrisitrdtsknqfflqlnsvttedtatyyctrwgdgyylywyfdvwgagttvtv
    s
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6h3uI (I:)
    qmqlqesgpglvkpsqslsltctvtgysitsdsawnwirqfpgnklewmgyisysgstsy
    npslksrisitrdtsknqfflqlnsvttedtatyyctrwgdgyylywyfdvwgagttvtv
    ssggggsggggsggggsggggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h3uI (I:)
    qmqlqesgpglvkpsqslsltctvtgysitsdsawnwirqfpgnklewmgyisysgstsy
    npslksrisitrdtsknqfflqlnsvttedtatyyctrwgdgyylywyfdvwgagttvtv
    ss
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6h3uL (L:)
    diqmtqttsslsaslgdrvtiscsasqgisyylnwyqqkpdgtvklliyytsslhsgvps
    rfsgsgsgtdysltisnlepediatyycqqysklpwtfgggtkleikggwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h3uL (L:)
    diqmtqttsslsaslgdrvtiscsasqgisyylnwyqqkpdgtvklliyytsslhsgvps
    rfsgsgsgtdysltisnlepediatyycqqysklpwtfgggtkleikggwshp
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6h3uM (M:)
    diqmtqttsslsaslgdrvtiscsasqgisyylnwyqqkpdgtvklliyytsslhsgvps
    rfsgsgsgtdysltisnlepediatyycqqysklpwtfgggtkleikggwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h3uM (M:)
    diqmtqttsslsaslgdrvtiscsasqgisyylnwyqqkpdgtvklliyytsslhsgvps
    rfsgsgsgtdysltisnlepediatyycqqysklpwtfgggtkleik