PDB entry 6h3t

View 6h3t on RCSB PDB site
Description: Schmallenberg Virus Glycoprotein Gc Head Domain in Complex with scFv 1C11
Class: viral protein
Keywords: Envelope Glycoprotein, scFv Antibody, VIRAL PROTEIN
Deposited on 2018-07-19, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 2.84 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelopment polyprotein
    Species: Bovine Schmallenberg virus [TaxId:1318464]
    Gene: GP
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Envelopment polyprotein
    Species: Bovine Schmallenberg virus [TaxId:1318464]
    Gene: GP
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: scFv 1C11 VH
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H3T (0-End)
    Domains in SCOPe 2.07: d6h3th_
  • Chain 'I':
    Compound: scFv 1C11 VH
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H3T (0-End)
    Domains in SCOPe 2.07: d6h3ti_
  • Chain 'L':
    Compound: scFv 1C11 VL
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H3T (0-End)
    Domains in SCOPe 2.07: d6h3tl_
  • Chain 'M':
    Compound: scFv 1C11 VL
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H3T (0-End)
    Domains in SCOPe 2.07: d6h3tm_
  • Heterogens: NAG, BMA, MAN, FUC

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6h3tH (H:)
    evqlqqsgpelvkpgasvkvsckasgysftdynmcwvkqshgkslewigyidpyngltsy
    npkfkgkatltvdkssstafmhlnsltsedsavyycarnyygrsyamdywgqgtsvtvss
    ggggsggggsggggsggggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h3tH (H:)
    evqlqqsgpelvkpgasvkvsckasgysftdynmcwvkqshgkslewigyidpyngltsy
    npkfkgkatltvdkssstafmhlnsltsedsavyycarnyygrsyamdywgqgtsvtv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6h3tI (I:)
    evqlqqsgpelvkpgasvkvsckasgysftdynmcwvkqshgkslewigyidpyngltsy
    npkfkgkatltvdkssstafmhlnsltsedsavyycarnyygrsyamdywgqgtsvtvss
    ggggsggggsggggsggggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h3tI (I:)
    evqlqqsgpelvkpgasvkvsckasgysftdynmcwvkqshgkslewigyidpyngltsy
    npkfkgkatltvdkssstafmhlnsltsedsavyycarnyygrsyamdywgqgtsvtv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6h3tL (L:)
    divmtqaasslavsvgekvtmsckssqsllyssnqknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvkaedlavyycqqyysfpptfgggtkleikggwshpq
    fek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h3tL (L:)
    divmtqaasslavsvgekvtmsckssqsllyssnqknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvkaedlavyycqqyysfpptfgggtkleik
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6h3tM (M:)
    divmtqaasslavsvgekvtmsckssqsllyssnqknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvkaedlavyycqqyysfpptfgggtkleikggwshpq
    fek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h3tM (M:)
    divmtqaasslavsvgekvtmsckssqsllyssnqknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvkaedlavyycqqyysfpptfgggtkleik