PDB entry 6h38

View 6h38 on RCSB PDB site
Description: The crystal structure of human carbonic anhydrase VII in complex with 4-[(4-fluorophenyl)methyl]-1-piperazinyl]benzenesulfonamide.
Class: lyase
Keywords: Protein-Inhibitor Binding, LYASE
Deposited on 2018-07-17, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 7
    Species: Homo sapiens [TaxId:9606]
    Gene: CA7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43166 (Start-265)
      • engineered mutation (186)
      • engineered mutation (220)
    Domains in SCOPe 2.07: d6h38a_
  • Heterogens: ZN, FKK, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h38A (A:)
    mgmtghhgwgygqddgpshwhklypiaqgdrqspiniissqavyspslqplelsyeacms
    lsitnnghsvqvdfndsddrtvvtggplegpyrlkqfhfhwgkkhdvgsehtvdgksfps
    elhlvhwnakkystfgeaasapdglavvgvfletgdehpsmnrltdalymvrfkgtkaqf
    scfnpksllpasrhywtypgslttpplsesvtwivlrepisiserqmgkfrsllftsedd
    erihmvnnfrppqplkgrvvkasfralehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h38A (A:)
    gwgygqddgpshwhklypiaqgdrqspiniissqavyspslqplelsyeacmslsitnng
    hsvqvdfndsddrtvvtggplegpyrlkqfhfhwgkkhdvgsehtvdgksfpselhlvhw
    nakkystfgeaasapdglavvgvfletgdehpsmnrltdalymvrfkgtkaqfscfnpks
    llpasrhywtypgslttpplsesvtwivlrepisiserqmgkfrsllftsedderihmvn
    nfrppqplkgrvvkasfra