PDB entry 6h23

View 6h23 on RCSB PDB site
Description: Crystal structure of the hClpP Y118A mutant with an activating small molecule
Class: hydrolase
Keywords: protease, small molecule, 14mer, serine protease, oligomerization, HYDROLASE
Deposited on 2018-07-13, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 3.09 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease proteolytic subunit, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16740
      • engineered mutation (61)
    Domains in SCOPe 2.07: d6h23a_
  • Chain 'B':
    Compound: ATP-dependent Clp protease proteolytic subunit, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16740
      • engineered mutation (61)
    Domains in SCOPe 2.07: d6h23b_
  • Chain 'C':
    Compound: ATP-dependent Clp protease proteolytic subunit, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16740
      • engineered mutation (61)
    Domains in SCOPe 2.07: d6h23c_
  • Chain 'D':
    Compound: ATP-dependent Clp protease proteolytic subunit, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16740
      • engineered mutation (61)
    Domains in SCOPe 2.07: d6h23d_
  • Chain 'E':
    Compound: ATP-dependent Clp protease proteolytic subunit, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16740
      • engineered mutation (61)
    Domains in SCOPe 2.07: d6h23e_
  • Chain 'F':
    Compound: ATP-dependent Clp protease proteolytic subunit, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16740
      • engineered mutation (61)
    Domains in SCOPe 2.07: d6h23f_
  • Chain 'G':
    Compound: ATP-dependent Clp protease proteolytic subunit, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16740
      • engineered mutation (61)
    Domains in SCOPe 2.07: d6h23g_
  • Chain 'H':
    Compound: ATP-dependent Clp protease proteolytic subunit, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16740
      • engineered mutation (61)
    Domains in SCOPe 2.07: d6h23h_
  • Chain 'I':
    Compound: ATP-dependent Clp protease proteolytic subunit, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16740
      • engineered mutation (61)
    Domains in SCOPe 2.07: d6h23i_
  • Chain 'J':
    Compound: ATP-dependent Clp protease proteolytic subunit, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16740
      • engineered mutation (61)
    Domains in SCOPe 2.07: d6h23j_
  • Chain 'K':
    Compound: ATP-dependent Clp protease proteolytic subunit, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16740
      • engineered mutation (61)
    Domains in SCOPe 2.07: d6h23k_
  • Chain 'L':
    Compound: ATP-dependent Clp protease proteolytic subunit, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16740
      • engineered mutation (61)
    Domains in SCOPe 2.07: d6h23l_
  • Chain 'M':
    Compound: ATP-dependent Clp protease proteolytic subunit, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16740
      • engineered mutation (61)
    Domains in SCOPe 2.07: d6h23m_
  • Chain 'N':
    Compound: ATP-dependent Clp protease proteolytic subunit, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16740
      • engineered mutation (61)
    Domains in SCOPe 2.07: d6h23n_
  • Heterogens: FJT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h23A (A:)
    plipivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpih
    mainspggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrim
    ihqpsggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaq
    efgildkvlvhppqdgedeptlvqkepveaapaaepvpastwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h23A (A:)
    diysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmainspggvvtaglaiy
    dtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpiaiqaeeimklkk
    qlyniyakhtkqslqviesamerdrymspmeaqefgildkvlvhp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6h23B (B:)
    plipivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpih
    mainspggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrim
    ihqpsggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaq
    efgildkvlvhppqdgedeptlvqkepveaapaaepvpastwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h23B (B:)
    diysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmainspggvvtaglaiy
    dtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpiaiqaeeimklkk
    qlyniyakhtkqslqviesamerdrymspmeaqefgildkvlvhpp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6h23C (C:)
    plipivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpih
    mainspggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrim
    ihqpsggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaq
    efgildkvlvhppqdgedeptlvqkepveaapaaepvpastwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h23C (C:)
    ydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmainspggvvtaglai
    ydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpiaiqaeeimklk
    kqlyniyakhtkqslqviesamerdrymspmeaqefgildkvlvhp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6h23D (D:)
    plipivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpih
    mainspggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrim
    ihqpsggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaq
    efgildkvlvhppqdgedeptlvqkepveaapaaepvpastwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h23D (D:)
    ydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmainspggvvtaglai
    ydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpiqaeeimklkkq
    lyniyakhtkqslqviesamerdrymspmeaqefgildkvlvhp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6h23E (E:)
    plipivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpih
    mainspggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrim
    ihqpsggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaq
    efgildkvlvhppqdgedeptlvqkepveaapaaepvpastwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h23E (E:)
    ydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmainspggvvtaglai
    ydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpiaiqaeeimklk
    kqlyniyakhtkqslqviesamerdrymspmeaqefgildkvlvhp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6h23F (F:)
    plipivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpih
    mainspggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrim
    ihqpsggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaq
    efgildkvlvhppqdgedeptlvqkepveaapaaepvpastwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h23F (F:)
    diysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmainspggvvtaglaiy
    dtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpdiaiqaeeimklk
    kqlyniyakhtkqslqviesamerdrymspmeaqefgildkvlvhp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6h23G (G:)
    plipivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpih
    mainspggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrim
    ihqpsggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaq
    efgildkvlvhppqdgedeptlvqkepveaapaaepvpastwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h23G (G:)
    ydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmainspggvvtaglai
    ydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpsdiaiqaeeimk
    lkkqlyniyakhtkqslqviesamerdrymspmeaqefgildkvlvhpp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6h23H (H:)
    plipivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpih
    mainspggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrim
    ihqpsggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaq
    efgildkvlvhppqdgedeptlvqkepveaapaaepvpastwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h23H (H:)
    ydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmainspggvvtaglai
    ydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpdiaiqaeeimkl
    kkqlyniyakhtkqslqviesamerdrymspmeaqefgildkvlvhp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6h23I (I:)
    plipivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpih
    mainspggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrim
    ihqpsggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaq
    efgildkvlvhppqdgedeptlvqkepveaapaaepvpastwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h23I (I:)
    ydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmainspggvvtaglai
    ydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpdiaiqaeeimkl
    kkqlyniyakhtkqslqviesamerdrymspmeaqefgildkvlvhp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6h23J (J:)
    plipivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpih
    mainspggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrim
    ihqpsggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaq
    efgildkvlvhppqdgedeptlvqkepveaapaaepvpastwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h23J (J:)
    ydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmainspggvvtaglai
    ydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpiaiqaeeimklk
    kqlyniyakhtkqslqviesamerdrymspmeaqefgildkvlvhp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6h23K (K:)
    plipivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpih
    mainspggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrim
    ihqpsggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaq
    efgildkvlvhppqdgedeptlvqkepveaapaaepvpastwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h23K (K:)
    ydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmainspggvvtaglai
    ydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpiaiqaeeimklk
    kqlyniyakhtkqslqviesamerdrymspmeaqefgildkvlvhp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6h23L (L:)
    plipivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpih
    mainspggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrim
    ihqpsggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaq
    efgildkvlvhppqdgedeptlvqkepveaapaaepvpastwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h23L (L:)
    ydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmainspggvvtaglai
    ydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpiaiqaeeimklk
    kqlyniyakhtkqslqviesamerdrymspmeaqefgildkvlvhp
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6h23M (M:)
    plipivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpih
    mainspggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrim
    ihqpsggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaq
    efgildkvlvhppqdgedeptlvqkepveaapaaepvpastwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h23M (M:)
    ydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmainspggvvtaglai
    ydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpiaiqaeeimklk
    kqlyniyakhtkqslqviesamerdrymspmeaqefgildkvlvhp
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6h23N (N:)
    plipivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpih
    mainspggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrim
    ihqpsggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaq
    efgildkvlvhppqdgedeptlvqkepveaapaaepvpastwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h23N (N:)
    ydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmainspggvvtaglai
    ydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpsiaiqaeeimkl
    kkqlyniyakhtkqslqviesamerdrymspmeaqefgildkvlvhpp