PDB entry 6h1n

View 6h1n on RCSB PDB site
Description: Crystal Structure of a Zebra-fish pro-survival protein NRZ-apo
Class: apoptosis
Keywords: Bcl-2 family, pro-survival protein, APOPTOSIS
Deposited on 2018-07-12, released 2018-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BCL2-like 10 (Apoptosis facilitator)
    Species: Danio rerio [TaxId:7955]
    Gene: bcl2l10, mcl1l, nr13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UWD5 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d6h1na1, d6h1na2
  • Heterogens: SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6h1nA (A:)
gplsmscwlreqtlllaedyisfcsgiqqtppsesaeamrylakemeqqhrtkfrslsqe
fldtcgadpskclqsvmrelvgdgkmnwgrvvsiftftgvlasellsrgensegsrrlae
tiadylggekqdwlvenggwegfcrffhnarq

    Sequence, based on observed residues (ATOM records): (download) 
    >6h1nA (A:)
gplsmscwlreqtlllaedyisfcsgiqqtppsesaeamrylakemeqqhrtkfrslsqe
fldtcgadpskclqsvmrelvgdgkmnwgrvvsiftftgvlasellsrgeegsrrlaeti
adylggekqdwlvenggwegfcrffhna