PDB entry 6h1i

View 6h1i on RCSB PDB site
Description: Crystal structure of human Pirin in complex with bisamide compound 2
Class: transcription
Keywords: Transcriptional coregulator, Quercetin 2, 3-dioxygenase, Inhibitor, TRANSCRIPTION
Deposited on 2018-07-11, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pirin
    Species: Homo sapiens [TaxId:9606]
    Gene: pir
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h1ia_
  • Heterogens: FJH, FE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h1iA (A:)
    gshmgsskkvtlsvlsreqsegvgarvrrsigrpelknldpfllfdefkggrpggfpdhp
    hrgfetvsylleggsmahedfcghtgkmnpgdlqwmtagrgilhaempcseepahglqlw
    vnlrssekmvepqyqelkseeipkpskdgvtvavisgealgikskvytrtptlyldfkld
    pgakhsqpipkgwtsfiytisgdvyigpddaqqkiephhtavlgegdsvqvenkdpkrsh
    fvliageplrepviqhgpfvmntneeisqaildfrnakngferaktwkskign
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h1iA (A:)
    skkvtlsvlsreqsegvgarvrrsigrpelknldpfllfdefkggrpggfpdhphrgfet
    vsylleggsmahedfcghtgkmnpgdlqwmtagrgilhaempcseepahglqlwvnlrss
    ekmvepqyqelkseeipkpskdgvtvavisgealgikskvytrtptlyldfkldpgakhs
    qpipkgwtsfiytisgdvyigpddaqqkiephhtavlgegdsvqvenkdpkrshfvliag
    eplrepviqhgpfvmntneeisqaildfrnakngferaktwkskign