PDB entry 6gy1

View 6gy1 on RCSB PDB site
Description: rat COMT in complex with inhibitor
Class: transferase
Keywords: Magnesium Ion Binding, O-Methyltransferase Activity, Neurotransmitter Catabolic Process, TRANSFERASE
Deposited on 2018-06-27, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol O-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: COMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gy1a_
  • Heterogens: MG, SAH, FGQ, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gy1A (A:)
    gsmgdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireys
    pslvlelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilnga
    sqdlipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpd
    flayvrgsssfecthyssyleymkvvdglekaiyqgpsspdks
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gy1A (A:)
    dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
    lelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdl
    ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
    vrgsssfecthyssyleymkvvdglekaiyqg