PDB entry 6gxg

View 6gxg on RCSB PDB site
Description: Tryparedoxin from Trypanosoma brucei in complex with CFT
Class: oxidoreductase
Keywords: Covalent Inhibitor, Photoreduction, Inhibitor-Induced Dimerization, Monomer-Dimer Mixture, OXIDOREDUCTASE
Deposited on 2018-06-27, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryparedoxin
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O77404 (4-144)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d6gxga1, d6gxga2
  • Chain 'B':
    Compound: tryparedoxin
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O77404 (4-146)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d6gxgb1, d6gxgb2
  • Chain 'C':
    Compound: tryparedoxin
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O77404 (4-146)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d6gxgc1, d6gxgc2
  • Heterogens: FFN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gxgA (A:)
    gamgsglakylpgatnllsksgevslgslvgktvflyfsaswcppcrgftpvlaefyekh
    hvaknfevvliswdenesdfhdyygkmpwlalpfdqrstvselgktfgvesiptlitina
    dtgaiigtqartrviedpdganfpw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gxgA (A:)
    amgsglakylpgatnllsksgevslgslvgktvflyfsaswcppcrgftpvlaefyekhh
    vaknfevvliswdenesdfhdyygkmpwlalpfdqrstvselgktfgvesiptlitinad
    tgaiigtqartrviedpdganfpw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gxgB (B:)
    gamgsglakylpgatnllsksgevslgslvgktvflyfsaswcppcrgftpvlaefyekh
    hvaknfevvliswdenesdfhdyygkmpwlalpfdqrstvselgktfgvesiptlitina
    dtgaiigtqartrviedpdganfpwpn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gxgC (C:)
    gamgsglakylpgatnllsksgevslgslvgktvflyfsaswcppcrgftpvlaefyekh
    hvaknfevvliswdenesdfhdyygkmpwlalpfdqrstvselgktfgvesiptlitina
    dtgaiigtqartrviedpdganfpwpn