PDB entry 6gxf

View 6gxf on RCSB PDB site
Description: The hit-and-return system enables efficient time-resolved serial synchrotron crystallography: RADDAM1
Class: hydrolase
Keywords: time-resolved crystallography, serial synchrotron crystallography (SSX), Pump-probe experiment, structural enzymology, HYDROLASE
Deposited on 2018-06-27, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluoroacetate Dehalogenase
    Species: Rhodopseudomonas palustris CGA009 [TaxId:258594]
    Gene: RPA1163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gxfa_
  • Chain 'B':
    Compound: Fluoroacetate Dehalogenase
    Species: Rhodopseudomonas palustris CGA009 [TaxId:258594]
    Gene: RPA1163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gxfb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gxfA (A:)
    ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
    kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyr
    laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
    kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
    kipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrff
    saapgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gxfA (A:)
    dladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviv
    adlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlald
    spgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakl
    aswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipv
    pmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gxfB (B:)
    ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
    kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyr
    laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
    kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
    kipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrff
    saapgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gxfB (B:)
    pdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkvi
    vadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlal
    dspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkak
    laswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkip
    vpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffsaa