PDB entry 6gwk

View 6gwk on RCSB PDB site
Description: The crystal structure of Hfq from Caulobacter crescentus
Class: RNA binding protein
Keywords: Hfq, Caulobacter, sRNA, RNA-protein interactions, natively unstructured protein, RNA BINDING PROTEIN
Deposited on 2018-06-25, released 2019-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwka_
  • Chain 'B':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwkb_
  • Chain 'C':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwkc_
  • Chain 'D':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwkd_
  • Chain 'E':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwke_
  • Chain 'F':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwkf_
  • Chain 'G':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwkg_
  • Chain 'H':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwkh_
  • Chain 'I':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwki_
  • Chain 'J':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwkj_
  • Chain 'K':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwkk_
  • Chain 'L':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwkl_
  • Chain 'M':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwkm_
  • Chain 'N':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwkn_
  • Chain 'O':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwko_
  • Chain 'P':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwkp_
  • Chain 'Q':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwkq_
  • Chain 'R':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwkr_
  • Chain 'S':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwks_
  • Chain 'T':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwkt_
  • Chain 'U':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwku_
  • Chain 'V':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwkv_
  • Chain 'W':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwkw_
  • Chain 'X':
    Compound: RNA-binding protein Hfq
    Species: Caulobacter vibrioides CB15 [TaxId:190650]
    Gene: hfq, CC_1745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwkx_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gwkA (A:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkA (A:)
    qnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaistim
    paq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gwkB (B:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkB (B:)
    kqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaisti
    mpaqpvqlyepsadadd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gwkC (C:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkC (C:)
    nlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaistimp
    aqpvqlyep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gwkD (D:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkD (D:)
    kqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaisti
    mpaqpvqlyepsadadd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6gwkE (E:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkE (E:)
    qnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaistim
    paqpvql
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6gwkF (F:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkF (F:)
    qnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaistim
    paqpvqly
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6gwkG (G:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkG (G:)
    nlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaistimp
    pvql
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6gwkH (H:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkH (H:)
    qnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaistim
    paqpvqlyepsadadd
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6gwkI (I:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkI (I:)
    qnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaistim
    paq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6gwkJ (J:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkJ (J:)
    kqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaisti
    mpaqpvqlyepsadadd
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6gwkK (K:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkK (K:)
    nlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaistimp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6gwkL (L:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkL (L:)
    qnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaistim
    paqpvqlyep
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6gwkM (M:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkM (M:)
    nlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaistimp
    aqpvql
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6gwkN (N:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkN (N:)
    qnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaistim
    paqpvqlyepsadadd
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >6gwkO (O:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkO (O:)
    qnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaistim
    paqpvqly
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >6gwkP (P:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkP (P:)
    kqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaisti
    mpaqpvqlyepsadadd
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >6gwkQ (Q:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkQ (Q:)
    qnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaistim
    p
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >6gwkR (R:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkR (R:)
    kqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaisti
    mpaqpvqlyep
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >6gwkS (S:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkS (S:)
    nlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaistimp
    aq
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >6gwkT (T:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkT (T:)
    kqnlqdtflnsvrktpltiflvngvklqgvvswfdnfcvllrqlvykhaistimpaqpvq
    lyepsadadd
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >6gwkU (U:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkU (U:)
    nlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaistimp
    aq
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >6gwkV (V:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkV (V:)
    kqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaisti
    mpaqpvqlyepsadadd
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >6gwkW (W:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkW (W:)
    qnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaistim
    paq
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >6gwkX (X:)
    msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
    aistimpaqpvqlyepsadadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwkX (X:)
    nlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaistimp
    aqpvqly