PDB entry 6guk

View 6guk on RCSB PDB site
Description: CDK2 in complex with CGP74514A
Class: cell cycle
Keywords: cdk2, inhibitor, cell cycle
Deposited on 2018-06-19, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2, CDKN2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6guka_
  • Heterogens: FC8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gukA (A:)
    gplgspefmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstairei
    sllkelnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqll
    qglafchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrape
    illgckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvts
    mpdykpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkp
    vphlrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gukA (A:)
    menfqkvekigegtygvvykarnkltgevvalkkirtaireisllkelnhpnivklldvi
    htenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchshrvlhrdlkp
    qnllintegaikladfglarafgvtlwyrapeillgckyystavdiwslgcifaemvtrr
    alfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpkwarqdfskvvppldedgr
    sllsqmlhydpnkrisakaalahpffqdvtkpvphlrl