PDB entry 6guf

View 6guf on RCSB PDB site
Description: CDK2/CyclinA in complex with CGP74514A
Class: cell cycle
Keywords: cdk2, cyclina, inhibitor, cell cycle
Deposited on 2018-06-19, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2, CDKN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (4-301)
      • expression tag (3)
    Domains in SCOPe 2.07: d6gufa1, d6gufa2
  • Chain 'B':
    Compound: Cyclin-A2
    Species: Bos taurus [TaxId:9913]
    Gene: CCNA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gufb1, d6gufb2
  • Chain 'C':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2, CDKN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d6gufc1, d6gufc2
  • Chain 'D':
    Compound: Cyclin-A2
    Species: Bos taurus [TaxId:9913]
    Gene: CCNA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gufd1, d6gufd2
  • Heterogens: 23D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gufA (A:)
    gpgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllk
    elnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgla
    fchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillg
    ckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdy
    kpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    rl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gufA (A:)
    smenfqkvekigegtygvvykarnkltgevvalkkirltegvpstaireisllkelnhpn
    ivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchshr
    vlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyyst
    avdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpk
    warqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gufB (B:)
    gvnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqne
    tlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkq
    vlrmehlvlkvlafdlaaptinqfltqyflhqqpanckveslamflgelslidadpylky
    lpsviaaaafhlalytvtgqswpeslvqktgytletlkpclldlhqtylrapqhaqqsir
    ekyknskyhgvsllnppetlnvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gufB (B:)
    vnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnet
    lhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqv
    lrmehlvlkvlafdlaaptinqfltqyflhqqpanckveslamflgelslidadpylkyl
    psviaaaafhlalytvtgqswpeslvqktgytletlkpclldlhqtylrapqhaqqsire
    kyknskyhgvsllnppetlnv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gufC (C:)
    gpgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllk
    elnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgla
    fchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillg
    ckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdy
    kpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    rl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gufC (C:)
    smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
    hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
    shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
    ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
    fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gufD (D:)
    gvnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqne
    tlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkq
    vlrmehlvlkvlafdlaaptinqfltqyflhqqpanckveslamflgelslidadpylky
    lpsviaaaafhlalytvtgqswpeslvqktgytletlkpclldlhqtylrapqhaqqsir
    ekyknskyhgvsllnppetlnvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gufD (D:)
    vnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnet
    lhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqv
    lrmehlvlkvlafdlaaptinqfltqyflhqqpanckveslamflgelslidadpylkyl
    psviaaaafhlalytvtgqswpeslvqktgytletlkpclldlhqtylrapqhaqqsire
    kyknskyhgvsllnppetlnv