PDB entry 6guc

View 6guc on RCSB PDB site
Description: CDK2/CyclinA in complex with SU9516
Class: cell cycle
Keywords: cdk2, cyclina, inhibitor, cell cycle
Deposited on 2018-06-19, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2, CDKN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d6guca1, d6guca2
  • Chain 'B':
    Compound: Cyclin-A2
    Species: Bos taurus [TaxId:9913]
    Gene: CCNA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gucb1, d6gucb2
  • Chain 'C':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2, CDKN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d6gucc1, d6gucc2
  • Chain 'D':
    Compound: Cyclin-A2
    Species: Bos taurus [TaxId:9913]
    Gene: CCNA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gucd1, d6gucd2
  • Heterogens: SU9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gucA (A:)
    gpgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllk
    elnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgla
    fchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillg
    ckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdy
    kpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    rl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gucA (A:)
    smenfqkvekigegtygvvykarnkltgevvalkkitegvpstaireisllkelnhpniv
    klldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchshrvl
    hrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyystav
    diwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpkwa
    rqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gucB (B:)
    gvnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqne
    tlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkq
    vlrmehlvlkvlafdlaaptinqfltqyflhqqpanckveslamflgelslidadpylky
    lpsviaaaafhlalytvtgqswpeslvqktgytletlkpclldlhqtylrapqhaqqsir
    ekyknskyhgvsllnppetlnvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gucB (B:)
    vnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnet
    lhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqv
    lrmehlvlkvlafdlaaptinqfltqyflhqqpanckveslamflgelslidadpylkyl
    psviaaaafhlalytvtgqswpeslvqktgytletlkpclldlhqtylrapqhaqqsire
    kyknskyhgvsllnppetlnv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gucC (C:)
    gpgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllk
    elnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgla
    fchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillg
    ckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdy
    kpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    rl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gucC (C:)
    smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
    hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
    shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
    ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
    fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gucD (D:)
    gvnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqne
    tlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkq
    vlrmehlvlkvlafdlaaptinqfltqyflhqqpanckveslamflgelslidadpylky
    lpsviaaaafhlalytvtgqswpeslvqktgytletlkpclldlhqtylrapqhaqqsir
    ekyknskyhgvsllnppetlnvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gucD (D:)
    vnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnet
    lhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqv
    lrmehlvlkvlafdlaaptinqfltqyflhqqpanckveslamflgelslidadpylkyl
    psviaaaafhlalytvtgqswpeslvqktgytletlkpclldlhqtylrapqhaqqsire
    kyknskyhgvsllnppetlnv