PDB entry 6gub

View 6gub on RCSB PDB site
Description: CDK2/CyclinA in complex with Flavopiridol
Class: cell cycle
Keywords: cdk2, cyclina, inhibitor, cell cycle
Deposited on 2018-06-19, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2, CDKN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d6guba1, d6guba2
  • Chain 'B':
    Compound: Cyclin-A2
    Species: Bos taurus [TaxId:9913]
    Gene: CCNA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gubb1, d6gubb2
  • Chain 'C':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2, CDKN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d6gubc1, d6gubc2
  • Chain 'D':
    Compound: Cyclin-A2
    Species: Bos taurus [TaxId:9913]
    Gene: CCNA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gubd1, d6gubd2
  • Heterogens: F9Z, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gubA (A:)
    gpgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllk
    elnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgla
    fchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillg
    ckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdy
    kpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    rl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gubA (A:)
    smenfqkvekigegtygvvykarnkltgevvalkkirltegvpstaireisllkelnhpn
    ivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchshr
    vlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyyst
    avdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpk
    warqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gubB (B:)
    gvnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqne
    tlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkq
    vlrmehlvlkvlafdlaaptinqfltqyflhqqpanckveslamflgelslidadpylky
    lpsviaaaafhlalytvtgqswpeslvqktgytletlkpclldlhqtylrapqhaqqsir
    ekyknskyhgvsllnppetlnvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gubB (B:)
    vnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnet
    lhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqv
    lrmehlvlkvlafdlaaptinqfltqyflhqqpanckveslamflgelslidadpylkyl
    psviaaaafhlalytvtgqswpeslvqktgytletlkpclldlhqtylrapqhaqqsire
    kyknskyhgvsllnppetlnv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gubC (C:)
    gpgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllk
    elnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgla
    fchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillg
    ckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdy
    kpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    rl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gubC (C:)
    smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
    hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
    shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
    ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
    fqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gubD (D:)
    gvnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqne
    tlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkq
    vlrmehlvlkvlafdlaaptinqfltqyflhqqpanckveslamflgelslidadpylky
    lpsviaaaafhlalytvtgqswpeslvqktgytletlkpclldlhqtylrapqhaqqsir
    ekyknskyhgvsllnppetlnvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gubD (D:)
    vnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnet
    lhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqv
    lrmehlvlkvlafdlaaptinqfltqyflhqqpanckveslamflgelslidadpylkyl
    psviaaaafhlalytvtgqswpeslvqktgytletlkpclldlhqtylrapqhaqqsire
    kyknskyhgvsllnppetlnv