PDB entry 6gtn

View 6gtn on RCSB PDB site
Description: Achromobacter cycloclastes copper nitrite reductase at pH 6.5
Class: oxidoreductase
Keywords: oxidoreductase, nitrite reductase
Deposited on 2018-06-18, released 2019-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase
    Species: Achromobacter cycloclastes [TaxId:223]
    Gene: nirK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gtna1, d6gtna2
  • Heterogens: CU, NO2, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gtnA (A:)
    mteqlqmtrrtmlagaalagavapllhtaqahaagaaaaagaapvdistlprvkvdlvkp
    pfvhahdqvaktgprvveftmtieekklvidregteihamtfngsvpgplmvvhendyve
    lrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkatkpgvfvyhcapegmv
    pwhvtsgmngaimvlprdglkdekgqpltydkiyyvgeqdfyvpkdeagnykkyetpgea
    yedavkamrtltpthivfngavgaltgdhaltaavgervlvvhsqanrdtrphligghgd
    yvwatgkfrnppdldqetwlipggtagaafytfrqpgvyayvnhnlieafelgaaghfkv
    tgewnddlmtsvvkpasm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gtnA (A:)
    distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
    vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
    kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvgeqdfyvpk
    deagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavgervlvvhsq
    anrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgvyayvnhn
    lieafelgaaghfkvtgewnddlmtsvvkpasm