PDB entry 6gsc

View 6gsc on RCSB PDB site
Description: Sphingobacterium sp. T2 manganese superoxide dismutase catalyses the oxidative demethylation of polymeric lignin via generation of hydroxyl radical
Class: oxidoreductase
Keywords: oxidoreductase, lignin valorisation, lignin oxidation, manganese keywds 2 superoxide dismutase, sphingobacterium
Deposited on 2018-06-13, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: SPHINGOBACTERIUM SPIRITIVORUM [TaxId:258]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0M3KL50 (26-204)
      • expression tag (0-25)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d6gsca1, d6gsca2, d6gsca3
  • Chain 'B':
    Compound: superoxide dismutase
    Species: SPHINGOBACTERIUM SPIRITIVORUM [TaxId:258]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0M3KL50 (26-205)
      • expression tag (0-25)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d6gscb1, d6gscb2, d6gscb3
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gscA (A:)
    dpftqfkqtplpyaydalegaidaktmeihyskhhagytanlnkaiagtpaekesienil
    akvsqysdavrnnagghynhelfwsiltpnkgtkpsaalqkaidetfgsldalkekinaa
    gaarfgsgwawlivdnggklqvtstpnqdnplmdftkekgtpilgidvwehayylryqnk
    radylttiwdvinweevsaryekal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gscB (B:)
    dpftqfkqtplpyaydalegaidaktmeihyskhhagytanlnkaiagtpaekesienil
    akvsqysdavrnnagghynhelfwsiltpnkgtkpsaalqkaidetfgsldalkekinaa
    gaarfgsgwawlivdnggklqvtstpnqdnplmdftkekgtpilgidvwehayylryqnk
    radylttiwdvinweevsaryekalk