PDB entry 6gqm

View 6gqm on RCSB PDB site
Description: Crystal structure of human c-KIT kinase domain in complex with a small molecule inhibitor, AZD3229
Class: signaling protein
Keywords: receptor tyrosine kinase, inhibitor, oncology, gastrointestinal stromal tumour, structure-based drug design, SIGNALING PROTEIN
Deposited on 2018-06-07, released 2018-09-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Mast/stem cell growth factor receptor Kit
  Species: Homo sapiens [TaxId:9606]
  Gene: KIT, SCFR
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10721
    • engineered mutation (22)
    • engineered mutation (62)
    • engineered mutation (84)
    • engineered mutation (104)
    • engineered mutation (115)
    • conflict (141)
    • conflict (143-145)
    • insertion (152)
    • conflict (153-156)
    • conflict (158)
    • engineered mutation (161)
    • engineered mutation (197)
    • engineered mutation (218)
    • engineered mutation (237)
    • engineered mutation (283)
    • engineered mutation (287)
    • engineered mutation (305)
    • engineered mutation (316)
  Domains in SCOPe 2.08: d6gqma_
• Chain 'B':
  Compound: Mast/stem cell growth factor receptor Kit
  Species: Homo sapiens [TaxId:9606]
  Gene: KIT, SCFR
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10721
    • engineered mutation (62)
    • engineered mutation (84)
    • engineered mutation (104)
    • engineered mutation (115)
    • conflict (141)
    • conflict (143-145)
    • conflict (154-156)
    • conflict (158)
    • engineered mutation (161)
    • engineered mutation (197)
    • engineered mutation (218)
    • engineered mutation (237)
    • engineered mutation (283)
    • engineered mutation (287)
    • engineered mutation (305)
    • engineered mutation (316)
• Heterogens: F8H, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6gqmA (A:)
  gshmpmyevqwkvveesngnnysyidptqlpydhkwefprnrlsfgktlgagafgkvvea
  taqgliksdaamtvavkmlkpsahsterealmselkvlsylgnhenivnllgacthggpt
  lviteyccygdllnflrrkrdefvpykvapedlykdfltlehllsfsyqvakgmaflask
  ncihrdlaarnillthgnitkicdfglardikndsnyvdkgnarlpvkwmapesifnsvy
  tfesdvwsygiflwelfslgsspypgmpvdskfykmikegfrmsspeyapaemydimktc
  wdadpdkrptfkqivqdiekqisestnh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6gqmA (A:)
  syidptqlpydhkwefprnrlsfgktlgagafgkvveataqgliksdaamtvavkmlkps
  ahsterealmselkvlsylgnhenivnllgacthggptlviteyccygdllnflrrkrde
  fvpylykdfltlehllsfsyqvakgmaflaskncihrdlaarnillthgnitkicdfgla
  rdikndsnyvdkgnarlpvkwmapesifnsvytfesdvwsygiflwelfslgsspypgmp
  vdskfykmikegfrmsspeyapaemydimktcwdadpdkrptfkqivqdiekqises
  

  
  
• Chain 'B':
  No sequence available.