PDB entry 6gql

View 6gql on RCSB PDB site
Description: Crystal structure of human c-KIT kinase domain in complex with AZD3229-analogue (compound 35)
Class: signaling protein
Keywords: receptor tyrosine kinase, inhibitor, oncology, gastrointestinal stromal tumour, structure-based drug design, SIGNALING PROTEIN
Deposited on 2018-06-07, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mast/stem cell growth factor receptor Kit
    Species: Homo sapiens [TaxId:9606]
    Gene: KIT, SCFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10721
      • engineered mutation (22)
      • engineered mutation (62)
      • engineered mutation (84)
      • engineered mutation (104)
      • engineered mutation (115)
      • conflict (141)
      • conflict (143-145)
      • insertion (152)
      • conflict (153-156)
      • conflict (158)
      • engineered mutation (161)
      • engineered mutation (197)
      • engineered mutation (218)
      • engineered mutation (237)
      • engineered mutation (283)
      • engineered mutation (287)
      • engineered mutation (305)
      • engineered mutation (316)
    Domains in SCOPe 2.07: d6gqla_
  • Chain 'B':
    Compound: Mast/stem cell growth factor receptor Kit
    Species: Homo sapiens [TaxId:9606]
    Gene: KIT, SCFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10721
      • engineered mutation (62)
      • engineered mutation (84)
      • engineered mutation (104)
      • engineered mutation (115)
      • conflict (141)
      • conflict (143-145)
      • conflict (156)
      • conflict (158)
      • engineered mutation (161)
      • engineered mutation (197)
      • engineered mutation (218)
      • engineered mutation (237)
      • engineered mutation (283)
      • engineered mutation (287)
      • engineered mutation (305)
      • engineered mutation (316)
  • Heterogens: F8B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gqlA (A:)
    gshmpmyevqwkvveesngnnysyidptqlpydhkwefprnrlsfgktlgagafgkvvea
    taqgliksdaamtvavkmlkpsahsterealmselkvlsylgnhenivnllgacthggpt
    lviteyccygdllnflrrkrdefvpykvapedlykdfltlehllsfsyqvakgmaflask
    ncihrdlaarnillthgnitkicdfglardikndsnyvdkgnarlpvkwmapesifnsvy
    tfesdvwsygiflwelfslgsspypgmpvdskfykmikegfrmsspeyapaemydimktc
    wdadpdkrptfkqivqdiekqisestnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gqlA (A:)
    ysyidptqlpydhkwefprnrlsfgktlgagafgkvveataqgliksdaamtvavkmlkp
    sahsterealmselkvlsylgnhenivnllgacthggptlviteyccygdllnflrrkrd
    efvpylykdfltlehllsfsyqvakgmaflaskncihrdlaarnillthgnitkicdfgl
    ardikndsnyvdkgnarlpvkwmapesifnsvytfesdvwsygiflwelfslgsspypgm
    pvdskfykmikegfrmsspeyapaemydimktcwdadpdkrptfkqivqdiekqises
    

  • Chain 'B':
    No sequence available.