PDB entry 6gpu

View 6gpu on RCSB PDB site
Description: Crystal structure of miniSOG at 1.17A resolution
Class: flavoprotein
Keywords: Singlet oxygen generator, fluorescent protein, FMN, FLAVOPROTEIN
Deposited on 2018-06-07, released 2019-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phototropin-2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PHOT2, CAV1, KIN7, NPL1, At5g58140, K21L19.6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P93025 (1-105)
      • initiating methionine (0)
      • conflict (3)
      • conflict (7)
      • conflict (22)
      • conflict (39)
      • conflict (83)
      • expression tag (106-114)
    Domains in SCOPe 2.08: d6gpua1, d6gpua2
  • Heterogens: FMN, CL, MG, CO, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6gpuA (A:)
meksfvitdprlpdnpiifasdgflelteysreeilgrngrflqgpetdqatvqkirdai
rdqreitvqlinytksgkkfwnllhlqpmrdqkgelqyfigvqldgefipnpllg