PDB entry 6gph

View 6gph on RCSB PDB site
Description: Structure of human Heat shock protein 90-alpha N-terminal domain (Hsp90-NTD) variant K112A in complex with AMPCP
Class: chaperone
Keywords: CHAPERONE, Hsp90, NTD, alpha, K112A, complex, AMPCP, nucleotide
Deposited on 2018-06-05, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07900 (20-End)
      • expression tag (13-19)
      • engineered mutation (131)
    Domains in SCOPe 2.07: d6gpha1, d6gpha2
  • Heterogens: A12, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gphA (A:)
    mgsshhhhhhssglvprgshmpeetqtqdqpmeeeevetfafqaeiaqlmsliintfysn
    keiflrelisnssdaldkiryesltdpskldsgkelhinlipnkqdrtltivdtgigmtk
    adlinnlgtiaasgtkafmealqagadismigqfgvgfysaylvaekvtvitkhnddeqy
    awessaggsftvrtdtgepmgrgtkvilhlkedqteyleerrikeivkkhsqfigypitl
    fvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gphA (A:)
    lvprgshmpeetqtqdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnss
    daldkiryesltdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaas
    gtkafmealqagadismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvr
    tdtgepmgrgtkvilhlkedqteyleerrikeivkkhsqfigypitlfveker