PDB entry 6gp8

View 6gp8 on RCSB PDB site
Description: Structure of human Heat shock protein 90-alpha N-terminal domain (Hsp90-NTD) variant K112A in complex AMPCPP
Class: chaperone
Keywords: CHAPERONE, Hsp90, NTD, alpha, K112A, complex, AMPCPP, nucleotide
Deposited on 2018-06-05, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07900 (20-End)
      • expression tag (14-19)
      • engineered mutation (131)
    Domains in SCOPe 2.07: d6gp8a1, d6gp8a2
  • Heterogens: APC, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gp8A (A:)
    mgsshhhhhhssglvprgshmpeetqtqdqpmeeeevetfafqaeiaqlmsliintfysn
    keiflrelisnssdaldkiryesltdpskldsgkelhinlipnkqdrtltivdtgigmtk
    adlinnlgtiaasgtkafmealqagadismigqfgvgfysaylvaekvtvitkhnddeqy
    awessaggsftvrtdtgepmgrgtkvilhlkedqteyleerrikeivkkhsqfigypitl
    fvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gp8A (A:)
    vprgshmpeetqtqdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssd
    aldkiryesltdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaasg
    tkafmealqagadismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrt
    dtgepmgrgtkvilhlkedqteyleerrikeivkkhsqfigypitlfveker