PDB entry 6go3

View 6go3 on RCSB PDB site
Description: TdT chimera (Loop1 of pol mu) - apoenzyme
Class: DNA binding protein
Keywords: NHEJ pathway, DNA bridging, DNA polymerase polX, DNA BINDING PROTEIN
Deposited on 2018-06-01, released 2019-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-05, with a file datestamp of 2019-05-30.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA nucleotidylexotransferase,DNA-directed DNA/RNA polymerase mu,DNA nucleotidylexotransferase
    Species: Mus musculus [TaxId:10090]
    Gene: DNTT, TDT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09838 (Start-266)
    • Uniprot Q9JIW4 (267-296)
      • conflict (290)
    • Uniprot P09838 (297-400)
    Domains in SCOPe 2.07: d6go3a1, d6go3a2, d6go3a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6go3A (A:)
    mgsshhhhhhssglvprgshmspspvpgsqnvpapavkkisqyacqrrttlnnynqlftd
    aldilaendelrenegsclafmrassvlkslpfpitsmkdtegipclgdkvksiiegiie
    dgesseakavlnderyksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqk
    agflyyedlvscvnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflits
    peatedeeqqllhkvtdfwkqqglllyhqyhrshladsahnlrqrsstmdvfersfcilk
    ldhgrvhseksgqqegkgwkairvdlvmcpydrrafallgwtgsrqferdlrryatherk
    mmldnhalydrtkrvfleaeseeeifahlgldyiepwerna
    

    Sequence, based on observed residues (ATOM records): (download)
    >6go3A (A:)
    kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits
    mkdtegipclgdkvksiiegiiedgesseakavlnderyksfklftsvfgvglktaekwf
    rmgfrtlskiqsdkslrftqmqkagflyyedlvscvnrpeaeavsmlvkeavvtflpdal
    vtmtggfrrgkmtghdvdflitspeatedeeqqllhkvtdfwkqqglllyhqyhrsvfer
    sfcilkldhgrvhsekegkgwkairvdlvmcpydrrafallgwtgsrqferdlrryathe
    rkmmldnhalydrtkrvfleaeseeeifahlgldyiepwerna