PDB entry 6gnd

View 6gnd on RCSB PDB site
Description: Crystal structure of the complex of a Ferredoxin-Flavin Thioredoxin Reductase and a Thioredoxin from Clostridium acetobutylicum at 2.9 A resolution
Class: oxidoreductase
Keywords: Flavoprotein, thioredoxin reductase, thioredoxin, OXIDOREDUCTASE
Deposited on 2018-05-30, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin reductase
    Species: Clostridium acetobutylicum ATCC 824 [TaxId:272562]
    Gene: CA_C3082
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97EM8
      • engineered mutation (133)
  • Chain 'B':
    Compound: thioredoxin
    Species: Clostridium acetobutylicum ATCC 824 [TaxId:272562]
    Gene: CA_C3083
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97EM7 (Start-107)
      • engineered mutation (35)
    Domains in SCOPe 2.07: d6gndb_
  • Chain 'C':
    Compound: thioredoxin reductase
    Species: Clostridium acetobutylicum ATCC 824 [TaxId:272562]
    Gene: CA_C3082
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97EM8 (3-End)
      • engineered mutation (133)
  • Chain 'D':
    Compound: thioredoxin
    Species: Clostridium acetobutylicum ATCC 824 [TaxId:272562]
    Gene: CA_C3083
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97EM7 (Start-107)
      • engineered mutation (35)
    Domains in SCOPe 2.07: d6gndd_
  • Chain 'E':
    Compound: thioredoxin reductase
    Species: Clostridium acetobutylicum ATCC 824 [TaxId:272562]
    Gene: CA_C3082
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97EM8
      • engineered mutation (133)
  • Chain 'F':
    Compound: thioredoxin
    Species: Clostridium acetobutylicum ATCC 824 [TaxId:272562]
    Gene: CA_C3083
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97EM7 (Start-107)
      • engineered mutation (35)
    Domains in SCOPe 2.07: d6gndf_
  • Chain 'G':
    Compound: thioredoxin reductase
    Species: Clostridium acetobutylicum ATCC 824 [TaxId:272562]
    Gene: CA_C3082
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97EM8 (3-End)
      • expression tag (2)
      • engineered mutation (133)
  • Chain 'H':
    Compound: thioredoxin
    Species: Clostridium acetobutylicum ATCC 824 [TaxId:272562]
    Gene: CA_C3083
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97EM7 (Start-107)
      • engineered mutation (35)
    Domains in SCOPe 2.07: d6gndh_
  • Heterogens: FAD, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gndB (B:)
    gshmvkeinesifdeeiktsgepvivdfwapwcgpskmlgpiidelsedldgkakftkvn
    vdenpgiaskfgiasiptvmifkdgnpvetlvgfrpkqsitasiekhm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gndB (B:)
    esifdeeiktsepvivdfwapwcgpskmlgpiidelsedldgkakftkvnvdenpgiask
    fgiasiptvmipvetlvgfrpkqsitasiekhm
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gndD (D:)
    gshmvkeinesifdeeiktsgepvivdfwapwcgpskmlgpiidelsedldgkakftkvn
    vdenpgiaskfgiasiptvmifkdgnpvetlvgfrpkqsitasiekhm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gndD (D:)
    esifdeeikepvivdfwapwcgpskmlgpiidelsedlgkakftkvnvdenpgiaskfgi
    asiptvmifkdgnpvetlvgfrpkqsitasiekhm
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6gndF (F:)
    gshmvkeinesifdeeiktsgepvivdfwapwcgpskmlgpiidelsedldgkakftkvn
    vdenpgiaskfgiasiptvmifkdgnpvetlvgfrpkqsitasiekhm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gndF (F:)
    esifdeeipvivdfwapwcgpskmlgpiidelsedldgkakftkvnvdenpgiaskfgia
    siptvmifpvetlvgfrpkqsitasiekhm
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6gndH (H:)
    gshmvkeinesifdeeiktsgepvivdfwapwcgpskmlgpiidelsedldgkakftkvn
    vdenpgiaskfgiasiptvmifkdgnpvetlvgfrpkqsitasiekhm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gndH (H:)
    sifdeeivdfwapwcgpskmlgpiidelsedldgkftkvnvdenpgiaskfgiasiptvm
    ivetlvgfrpkqsitasiekhm