PDB entry 6gm2

View 6gm2 on RCSB PDB site
Description: [FeFe]-hydrogenase CpI from Clostridium pasteurianum, variant E282D
Class: oxidoreductase
Keywords: Hydrogenase, H-cluster, OXIDOREDUCTASE, semisynthetic enzyme
Deposited on 2018-05-24, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron hydrogenase 1
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29166 (Start-573)
      • engineered mutation (281)
      • expression tag (574-578)
    Domains in SCOPe 2.07: d6gm2a1, d6gm2a2, d6gm2a3, d6gm2a4
  • Chain 'B':
    Compound: Iron hydrogenase 1
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29166
      • engineered mutation (281)
    Domains in SCOPe 2.07: d6gm2b1, d6gm2b2, d6gm2b3
  • Heterogens: 402, SF4, FES, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gm2A (A:)
    mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt
    acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara
    skpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigae
    dekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigel
    fnmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeeatdlvqrienngpfpmftscc
    pgwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkf
    eadrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgat
    ggvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkf
    mksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskr
    kshentalvkmyqnyfgkpgegraheilhfkykksawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gm2A (A:)
    ktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvta
    cdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykaras
    kpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaed
    ekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigelf
    nmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeeatdlvqrienngpfpmftsccp
    gwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkfe
    adrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgatg
    gvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkfm
    ksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskrk
    shentalvkmyqnyfgkpgegraheilhfkykksawsh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gm2B (B:)
    mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt
    acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara
    skpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigae
    dekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigel
    fnmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeeatdlvqrienngpfpmftscc
    pgwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkf
    eadrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgat
    ggvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkf
    mksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskr
    kshentalvkmyqnyfgkpgegraheilhfkykksawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gm2B (B:)
    ktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvta
    cdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykaras
    kpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaed
    ekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigelf
    nmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeeatdlvqrienngpfpmftsccp
    gwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkfe
    adrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgatg
    gvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkfm
    ksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskrk
    shentalvkmyqnyfgkpgegraheilhfkyk