PDB entry 6gkp

View 6gkp on RCSB PDB site
Description: Crystal structure of branched-chain amino acid aminotransferase from Thermobaculum terrenum in PMP-form
Class: transferase
Keywords: branched-chain, aminotransferase, PLP, PMP, transaminase, thermophlic, dimer, TRANSFERASE
Deposited on 2018-05-21, released 2018-09-26
Made obsolete by 6q8e on 2019-01-02

The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: branched-chain-amino-acid aminotransferase
    Species: Thermobaculum terrenum ATCC BAA-798 [TaxId:525904]
    Gene: ilvE, Tter_1720
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gkpa_
  • Heterogens: PMP, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gkpA (A:)
    msqqenpkylwwnhriipweeatvhltdywwasvtavfegirgywnnaegemyifrledh
    arrleqsmqlirmpkeftvdeicqatidlvrandyrgdvyimplayavgnkafsvvgdrt
    temfiysrpavsrleedfslhacysswtrinervlpprikalanyrnsqlasseaamngy
    dtalflnpegkvaegtgscvffvrkgklitpditsgilesitrdtvihlarevlglevee
    rvvdrtetyladeaflcgthaeitpiasidrhemkhgapgpitrqlrdiyrevvygrdfr
    yrnwltpvgmgvraeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gkpA (A:)
    enpkylwwnhriipweeatvhltdywwasvtavfegirgywnnaegemyifrledharrl
    eqsmqlirmpkeftvdeicqatidlvrandyrgdvyimplayavgnkafsvvgdrttemf
    iysrpavsrleedfslhacysswtrinervlpprikalanyrnsqlasseaamngydtal
    flnpegkvaegtgscvffvrkgklitpditsgilesitrdtvihlarevlgleveervvd
    rtetyladeaflcgthaeitpiasidrhemkhgapgpitrqlrdiyrevvygrdfryrnw
    ltpvgmg