PDB entry 6gh7

View 6gh7 on RCSB PDB site
Description: WILDTYPE CORE-STREPTAVIDIN WITH BIOTIN A with a catalyst
Class: biotin-binding protein
Keywords: BIOTIN-BINDING PROTEIN, Organocatalysis, Supramolecular chemistry, secondary amine, artificial enzyme
Deposited on 2018-05-04, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gh7a_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gh7b_
  • Chain 'C':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gh7c_
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gh7d_
  • Heterogens: EYW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gh7A (A:)
    maeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgt
    algwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtft
    kvkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gh7A (A:)
    agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
    wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gh7B (B:)
    maeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgt
    algwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtft
    kvkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gh7B (B:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gh7C (C:)
    maeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgt
    algwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtft
    kvkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gh7C (C:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gh7D (D:)
    maeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgt
    algwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtft
    kvkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gh7D (D:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv