PDB entry 6gfz

View 6gfz on RCSB PDB site
Description: pVHL:EloB:EloC in complex with modified VH032 containing (3S,4S)-3-fluoro-4-hydroxyproline (ligand 14b)
Class: ligase
Keywords: protein complex, ubiquitin ligase, hypoxia inducible factor, fluorinated hydroxyproline, LIGASE
Deposited on 2018-05-02, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOB, TCEB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gfza_
  • Chain 'B':
    Compound: Elongin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOC, TCEB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15369 (1-96)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6gfzb1, d6gfzb2
  • Chain 'C':
    Compound: von hippel-lindau disease tumor suppressor
    Species: Homo sapiens [TaxId:9606]
    Gene: VHL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gfzc_
  • Chain 'D':
    Compound: Elongin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOB, TCEB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gfzd_
  • Chain 'E':
    Compound: Elongin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOC, TCEB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15369 (1-96)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6gfze1, d6gfze2
  • Chain 'F':
    Compound: von hippel-lindau disease tumor suppressor
    Species: Homo sapiens [TaxId:9606]
    Gene: VHL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gfzf_
  • Chain 'G':
    Compound: Elongin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOB, TCEB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gfzg_
  • Chain 'H':
    Compound: Elongin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOC, TCEB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15369 (1-96)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6gfzh1, d6gfzh2
  • Chain 'I':
    Compound: von hippel-lindau disease tumor suppressor
    Species: Homo sapiens [TaxId:9606]
    Gene: VHL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gfzi_
  • Chain 'J':
    Compound: Elongin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOB, TCEB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gfzj_
  • Chain 'K':
    Compound: Elongin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOC, TCEB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15369 (1-96)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6gfzk1, d6gfzk2
  • Chain 'L':
    Compound: von hippel-lindau disease tumor suppressor
    Species: Homo sapiens [TaxId:9606]
    Gene: VHL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gfzl_
  • Heterogens: EXE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gfzA (A:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gfzB (B:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gfzB (B:)
    mmyvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytn
    ssteipefpiapeialellmaanfldc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gfzC (C:)
    gsmeagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihs
    yrghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvk
    penyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gfzC (C:)
    vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
    agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
    rslyedledhpnvqkdlerlt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gfzD (D:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gfzD (D:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvm
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6gfzE (E:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gfzE (E:)
    mmyvklissdghefivkrehaltsgtikamlsgnetnevnfreipshvlskvcmyftykv
    rytnssteipefpiapeialellmaanfldc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6gfzF (F:)
    gsmeagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihs
    yrghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvk
    penyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gfzF (F:)
    vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
    agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
    rslyedledhpnvqkdlerltqe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6gfzG (G:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gfzG (G:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvm
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6gfzH (H:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gfzH (H:)
    mmyvklissdghefivkrehaltsgtikamlsgtnevnfreipshvlskvcmyftykvry
    tnssteipefpiapeialellmaanfldc
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6gfzI (I:)
    gsmeagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihs
    yrghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvk
    penyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gfzI (I:)
    vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
    agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
    rslyedledhpnvqkdlerltqe
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6gfzJ (J:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gfzJ (J:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvm
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6gfzK (K:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gfzK (K:)
    mmyvklissdghefivkrehaltsgtikamlstnevnfreipshvlskvcmyftykvryt
    nssteipefpiapeialellmaanfldc
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6gfzL (L:)
    gsmeagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihs
    yrghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvk
    penyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gfzL (L:)
    vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
    agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
    rslyedledhpnvqkdlerltqe