PDB entry 6gfk

View 6gfk on RCSB PDB site
Description: delta-N METTL16 MTase domain
Class: transferase
Keywords: SAM methyltransferase, TRANSFERASE
Deposited on 2018-04-30, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: METTL16, METT10D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gfka_
  • Chain 'B':
    Compound: U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: METTL16, METT10D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gfkb_
  • Chain 'C':
    Compound: U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: METTL16, METT10D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gfkc_
  • Heterogens: SAH, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gfkA (A:)
    rvslnfkdpeavraltctllredfglsidiplerliptvplrlnyihwvedlighqdsdk
    stlrrgidigtgasciypllgatlngwyflatevddmcfnyakknveqnnlsdlikvvkv
    pqktllmdalkeeseiiydfcmcnppffanqleakgvnsrnprrpppssvntggiteima
    eggelefvkriihdslqlkkrlrwyscmlgkkcslaplkeelriqgvpkvtytefcqgrt
    mrwalawsfyd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gfkA (A:)
    rvslnfkdpeavraltctllredfglsidiplerliptvplrlnyihwvedlighqdsdk
    stlrrgidigtgasciypllgatlngwyflatevddmcfnyakknveqnnlsdlikvvkv
    pqktllmdalkeeseiiydfcmcnppffanqggiteimaeggelefvkriihdslqlkkr
    lrwyscmlgkkcslaplkeelriqgvpkvtytefcqgrtmrwalawsfyd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gfkB (B:)
    rvslnfkdpeavraltctllredfglsidiplerliptvplrlnyihwvedlighqdsdk
    stlrrgidigtgasciypllgatlngwyflatevddmcfnyakknveqnnlsdlikvvkv
    pqktllmdalkeeseiiydfcmcnppffanqleakgvnsrnprrpppssvntggiteima
    eggelefvkriihdslqlkkrlrwyscmlgkkcslaplkeelriqgvpkvtytefcqgrt
    mrwalawsfyd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gfkB (B:)
    slnfkdpeavraltctllredfglsidiplerliptvplrlnyihwvedlighstlrrgi
    digtgasciypllgatlngwyflatevddmcfnyakknveqnnlsdlikvvkvpqktllm
    dalkeeiiydfcmcnppffanggiteimaeggelefvkriihdslqlkkrlrwyscmlgk
    kcslaplkeelriqgvpkvtytefcqgrtmrwalawsfyd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gfkC (C:)
    rvslnfkdpeavraltctllredfglsidiplerliptvplrlnyihwvedlighqdsdk
    stlrrgidigtgasciypllgatlngwyflatevddmcfnyakknveqnnlsdlikvvkv
    pqktllmdalkeeseiiydfcmcnppffanqleakgvnsrnprrpppssvntggiteima
    eggelefvkriihdslqlkkrlrwyscmlgkkcslaplkeelriqgvpkvtytefcqgrt
    mrwalawsfyd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gfkC (C:)
    slnfkdpeavraltctllredfglsidiplerliptvplrlnyihwvedlighqdstlrr
    gidigtgasciypllgatlngwyflatevddmcfnyakknveqnnlsdlikvvkvpqktl
    lmdalkiiydfcmcnppffanqlteimaeggelefvkriihdslqlkkrlrwyscmlgkk
    cslaplkeelriqgvpkvtytefcqgrtmrwalawsfy