PDB entry 6gf1

View 6gf1 on RCSB PDB site
Description: The structure of the ubiquitin-like modifier FAT10 reveals a novel targeting mechanism for degradation by the 26S proteasome
Class: signaling protein
Keywords: Ubiquitin-like, degradation, SIGNALING PROTEIN
Deposited on 2018-04-28, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin D
    Species: Homo sapiens [TaxId:9606]
    Gene: UBD, FAT10
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15205 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.07: d6gf1a1, d6gf1a2
  • Chain 'B':
    Compound: Ubiquitin D
    Species: Homo sapiens [TaxId:9606]
    Gene: UBD, FAT10
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15205 (6-End)
      • expression tag (2-5)
    Domains in SCOPe 2.07: d6gf1b1, d6gf1b2
  • Chain 'C':
    Compound: Ubiquitin D
    Species: Homo sapiens [TaxId:9606]
    Gene: UBD, FAT10
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15205 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.07: d6gf1c1, d6gf1c2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gf1A (A:)
    gastltvhvrseewdlmtfdanpydsvkkikehvrsktkvpvqdqvlllgskilkprrsl
    ssygidkektihltlkvvkpsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gf1A (A:)
    tltvhvrseewdlmtfdanpydsvkkikehvrsktkvpvqdqvlllgskilkprrslssy
    gidkektihltlkvvkps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gf1B (B:)
    gastltvhvrseewdlmtfdanpydsvkkikehvrsktkvpvqdqvlllgskilkprrsl
    ssygidkektihltlkvvkpsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gf1B (B:)
    stltvhvrseewdlmtfdanpydsvkkikehvrsktkvpvqdqvlllgskilkprrslss
    ygidkektihltlkvvkps
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gf1C (C:)
    gastltvhvrseewdlmtfdanpydsvkkikehvrsktkvpvqdqvlllgskilkprrsl
    ssygidkektihltlkvvkpsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gf1C (C:)
    tltvhvrseewdlmtfdanpydsvkkikehvrsktkvpvqdqvlllgskilkprrslskt
    ihltlkvvkps