PDB entry 6ger

View 6ger on RCSB PDB site
Description: Wheat b-amylase, a clinically relevant food allergen
Class: hydrolase
Keywords: TIM barrel, wheat allergen, food allergen, hydrolase
Deposited on 2018-04-27, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-amylase
    Species: TRITICUM AESTIVUM [TaxId:4565]
    Gene: BMY1, AMY1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gera_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gerA (A:)
    magnmlanyvqvyvmlpldvvsvdnkfekgdeiraqlkklteagvdgvmidvwwglvegk
    gpkaydwsaykqvfdlvheaglklqaimsfhqcggnvgdvvnipipqwvrdvgatdpdif
    ytnrggtrnieyltlgvddqplfhgrtavqmyadymasfrenmkkfldagtivdievglg
    pagemrypsypqsqgwvfpgigeficydkyleadfkaaaakaghpewelpddageyndtp
    ektqffkdngtyltekgkfflswysnklikhgdkildeankvflgcrvqlaikisgihww
    yrvpnhaaeltagyynlddrdgyrtiarmltrhhasmnftcaemrdseqseeaksapeel
    vqqvlsagwreglhvacenalgrydatayntilrnarpkginkngppehklfgftylrls
    nellegqnyatfqtfvekmhanlghdpsvdpvaplerskpempiemilkaaqpklepfpf
    dkntdlpvkdhtdvgdevlvapvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gerA (A:)
    gnmlanyvqvyvmlpldvvsvdnkfekgdeiraqlkklteagvdgvmidvwwglvegkgp
    kaydwsaykqvfdlvheaglklqaimsfhqcggnvgdvvnipipqwvrdvgatdpdifyt
    nrggtrnieyltlgvddqplfhgrtavqmyadymasfrenmkkfldagtivdievglgpa
    gemrypsypqsqgwvfpgigeficydkyleadfkaaaakaghpewelpddageyndtpek
    tqffkdngtyltekgkfflswysnklikhgdkildeankvflgcrvqlaikisgihwwyr
    vpnhaaeltagyynlddrdgyrtiarmltrhhasmnftcaemrdseqseeaksapeelvq
    qvlsagwreglhvacenalgrydatayntilrnarpkginkngppehklfgftylrlsne
    llegqnyatfqtfvekmhanlghdpsvdpvaplerskpempiemilkaaqpklepfpfdk
    ntdlpvkd