PDB entry 6gbx

View 6gbx on RCSB PDB site
Description: Crystal structure of human glutaminyl cyclase variant Y115E-Y117E in complex with SEN177
Class: transferase
Keywords: Inhibitor, Cyclotransferase, zinc enzyme, Alzheimer, TRANSFERASE
Deposited on 2018-04-16, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaminyl-peptide cyclotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: QPCT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16769 (Start-328)
      • engineered mutation (82)
      • engineered mutation (84)
    Domains in SCOPe 2.07: d6gbxa_
  • Chain 'B':
    Compound: Glutaminyl-peptide cyclotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: QPCT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16769 (Start-328)
      • engineered mutation (82)
      • engineered mutation (84)
    Domains in SCOPe 2.07: d6gbxb_
  • Chain 'C':
    Compound: Glutaminyl-peptide cyclotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: QPCT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16769 (Start-328)
      • engineered mutation (82)
      • engineered mutation (84)
    Domains in SCOPe 2.07: d6gbxc_
  • Heterogens: S77, ZN, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gbxA (A:)
    asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim
    qriqrlqadwvleidtflsqtpegersfsniistlnptakrhlvlachydskyfshwnnr
    vfvgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgeeaflhwspqds
    lygsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlq
    aiehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtm
    ddneenldestidnlnkilqvfvleylhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gbxA (A:)
    sawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhimq
    riqrlqadwvleidtflsqtpegersfsniistlnptakrhlvlachydskyfshwnnrv
    fvgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgeeaflhwspqdsl
    ygsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlqa
    iehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtmd
    dneenldestidnlnkilqvfvleylhl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gbxB (B:)
    asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim
    qriqrlqadwvleidtflsqtpegersfsniistlnptakrhlvlachydskyfshwnnr
    vfvgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgeeaflhwspqds
    lygsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlq
    aiehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtm
    ddneenldestidnlnkilqvfvleylhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gbxB (B:)
    sawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhimq
    riqrlqadwvleidtflsqtpegersfsniistlnptakrhlvlachydskyfshwnnrv
    fvgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgeeaflhwspqdsl
    ygsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlqa
    iehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtmd
    dneenldestidnlnkilqvfvleylhl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gbxC (C:)
    asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim
    qriqrlqadwvleidtflsqtpegersfsniistlnptakrhlvlachydskyfshwnnr
    vfvgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgeeaflhwspqds
    lygsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlq
    aiehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtm
    ddneenldestidnlnkilqvfvleylhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gbxC (C:)
    sawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhimq
    riqrlqadwvleidtflsqtpegersfsniistlnptakrhlvlachydskyfshwnnrv
    fvgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgeeaflhwspqdsl
    ygsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlqa
    iehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtmd
    dneenldestidnlnkilqvfvleylhl