PDB entry 6gbl

View 6gbl on RCSB PDB site
Description: Repertoires of functionally diverse enzymes through computational design at epistatic active-site positions
Class: hydrolase
Keywords: Phosphotriesterase, HYDROLASE
Deposited on 2018-04-15, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Parathion hydrolase
    Species: Brevundimonas diminuta [TaxId:293]
    Gene: OPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A434
      • engineered mutation (24)
      • engineered mutation (47)
      • engineered mutation (76)
      • engineered mutation (81)
      • engineered mutation (88)
      • engineered mutation (152)
      • engineered mutation (155)
      • engineered mutation (173)
      • engineered mutation (184)
      • engineered mutation (192)
      • engineered mutation (208)
      • engineered mutation (224)
      • engineered mutation (227)
      • engineered mutation (239)
      • engineered mutation (244)
      • engineered mutation (263-264)
      • engineered mutation (273)
      • engineered mutation (313)
      • engineered mutation (317-318)
      • engineered mutation (320)
      • engineered mutation (322)
    Domains in SCOPe 2.07: d6gbla_
  • Chain 'B':
    Compound: Parathion hydrolase
    Species: Brevundimonas diminuta [TaxId:293]
    Gene: OPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A434
      • engineered mutation (24)
      • engineered mutation (47)
      • engineered mutation (76)
      • engineered mutation (81)
      • engineered mutation (88)
      • engineered mutation (152)
      • engineered mutation (155)
      • engineered mutation (173)
      • engineered mutation (184)
      • engineered mutation (192)
      • engineered mutation (208)
      • engineered mutation (224)
      • engineered mutation (227)
      • engineered mutation (239)
      • engineered mutation (244)
      • engineered mutation (263-264)
      • engineered mutation (273)
      • engineered mutation (313)
      • engineered mutation (317-318)
      • engineered mutation (320)
      • engineered mutation (322)
    Domains in SCOPe 2.07: d6gblb_
  • Heterogens: FMT, ZN, EDO, CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gblA (A:)
    itnsgdrintvrgpitiseagftlmhehicgssagflrawpeffgsrdalaekavrglrr
    araagvrtivdvstfdlgrdvellaevseaadvhivaatglwfdpplsmrlrsveeltqf
    flreiqygiedtgiragiikvattgkatpfqervlraaaraslatgvpvtthtdasqrdg
    eqqadifesegldpsrvcighsddtddldyltalaargyligldgipwsaiglednasaa
    allglrswqtrallikalidqgyadqilvsndwtfgfssyvtnimdvmdrvnpdgmafip
    lrvipflrekgvpdetletimvdnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gblA (A:)
    drintvrgpitiseagftlmhehicgssagflrawpeffgsrdalaekavrglrraraag
    vrtivdvstfdlgrdvellaevseaadvhivaatglwfdpplsmrlrsveeltqfflrei
    qygiedtgiragiikvattgkatpfqervlraaaraslatgvpvtthtdasqrdgeqqad
    ifesegldpsrvcighsddtddldyltalaargyligldgipwsaiglednasaaallgl
    rswqtrallikalidqgyadqilvsndwtfgfssyvtnimdvmdrvnpdgmafiplrvip
    flrekgvpdetletimvdnparflsptl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gblB (B:)
    itnsgdrintvrgpitiseagftlmhehicgssagflrawpeffgsrdalaekavrglrr
    araagvrtivdvstfdlgrdvellaevseaadvhivaatglwfdpplsmrlrsveeltqf
    flreiqygiedtgiragiikvattgkatpfqervlraaaraslatgvpvtthtdasqrdg
    eqqadifesegldpsrvcighsddtddldyltalaargyligldgipwsaiglednasaa
    allglrswqtrallikalidqgyadqilvsndwtfgfssyvtnimdvmdrvnpdgmafip
    lrvipflrekgvpdetletimvdnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gblB (B:)
    drintvrgpitiseagftlmhehicgssagflrawpeffgsrdalaekavrglrraraag
    vrtivdvstfdlgrdvellaevseaadvhivaatglwfdpplsmrlrsveeltqfflrei
    qygiedtgiragiikvattgkatpfqervlraaaraslatgvpvtthtdasqrdgeqqad
    ifesegldpsrvcighsddtddldyltalaargyligldgipwsaiglednasaaallgl
    rswqtrallikalidqgyadqilvsndwtfgfssyvtnimdvmdrvnpdgmafiplrvip
    flrekgvpdetletimvdnparflspt