PDB entry 6gb8

View 6gb8 on RCSB PDB site
Description: Copper nitrite reductase from Achromobacter cycloclastes: small cell polymorph dataset 1
Class: oxidoreductase
Keywords: Copper, denitrification, serial synchrotron crystallography, polymorphs, nitrite reductase, OXIDOREDUCTASE
Deposited on 2018-04-13, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase
    Species: Achromobacter cycloclastes [TaxId:223]
    Gene: nirK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gb8a1, d6gb8a2
  • Heterogens: CU, NO2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gb8A (A:)
    aagaapvdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteih
    amtfngsvpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeet
    tlrfkatkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvge
    qdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavger
    vlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgv
    yayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gb8A (A:)
    distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
    vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
    kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvgeqdfyvpk
    deagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavgervlvvhsq
    anrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgvyayvnhn
    lieafelgaaghfkvtgewnddlmtsvvkpasm