PDB entry 6gaq

View 6gaq on RCSB PDB site
Description: Crystal structure of oxidised Flavodoxin 2 from Bacillus cereus
Class: electron transport
Keywords: flavodoxin, electron transfer, FMN, ELECTRON TRANSPORT
Deposited on 2018-04-12, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) [TaxId:226900]
    Gene: BC_3541
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gaqa_
  • Chain 'B':
    Compound: flavodoxin
    Species: Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) [TaxId:226900]
    Gene: BC_3541
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gaqb_
  • Heterogens: FMN, CA, PG4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gaqA (A:)
    mlegdakvakiliayasmsgntesiadlikvsldafdhevvlqemegmdaeellaydgii
    lgsytwgdgelpfeaedfhddlenidlagkkvavfgsgdtayelfceavtifeerlverg
    aelvqeglkielapedeedvekcsnfaiafaekf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gaqA (A:)
    akiliayasmsgntesiadlikvsldafdhevvlqemegmdaeellaydgiilgsytwgd
    gelpfeaedfhddlenidlagkkvavfgsgdtayelfceavtifeerlvergaelvqegl
    kielapedeedvekcsnfaiafaekf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gaqB (B:)
    mlegdakvakiliayasmsgntesiadlikvsldafdhevvlqemegmdaeellaydgii
    lgsytwgdgelpfeaedfhddlenidlagkkvavfgsgdtayelfceavtifeerlverg
    aelvqeglkielapedeedvekcsnfaiafaekf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gaqB (B:)
    akiliayasmsgntesiadlikvsldafdhevvlqemegmdaeellaydgiilgsytwgd
    gelpfeaedfhddlenidlagkkvavfgsgdtayelfceavtifeerlvergaelvqegl
    kielapedeedvekcsnfaiafaekf