PDB entry 6g7p

View 6g7p on RCSB PDB site
Description: Trichodesmium Tery_3377 (IdiA) (FutA) with iron and water ligands.
Class: transport protein
Keywords: Iron, IdiA, FutA, ABC-Transporter, Metal binding protein, transport protein
Deposited on 2018-04-06, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Extracellular solute-binding protein, family 1
    Species: Trichodesmium erythraeum IMS101 [TaxId:203124]
    Gene: Tery_3377
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10Z45 (0-315)
      • expression tag (316-317)
    Domains in SCOPe 2.07: d6g7pa1, d6g7pa2
  • Chain 'B':
    Compound: Extracellular solute-binding protein, family 1
    Species: Trichodesmium erythraeum IMS101 [TaxId:203124]
    Gene: Tery_3377
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10Z45 (0-315)
      • expression tag (316-317)
    Domains in SCOPe 2.07: d6g7pb1, d6g7pb2
  • Heterogens: FE, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6g7pA (A:)
    gainlyssrhydtdqalydsftkktglkvnliegkgdklierikseganspadvfmtvda
    grlwraqeagilqpissstlnnkipanlrspeklwfgfskrarvimynknkvqpselsty
    edlaqnkwkgkivirsssniynqsliaslieihgmsdaegwakgfvrnfarppegndtaq
    ikavaagigdiglansyylarlkrsskpedqavadkvgmffpnqngrgthvnisgggvvk
    napnkegaikfleylvspeaqkifsegnneypvvagvpiasvlkpfgsfkndstnvsvyg
    klnadaiklmdrvgwkle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6g7pB (B:)
    gainlyssrhydtdqalydsftkktglkvnliegkgdklierikseganspadvfmtvda
    grlwraqeagilqpissstlnnkipanlrspeklwfgfskrarvimynknkvqpselsty
    edlaqnkwkgkivirsssniynqsliaslieihgmsdaegwakgfvrnfarppegndtaq
    ikavaagigdiglansyylarlkrsskpedqavadkvgmffpnqngrgthvnisgggvvk
    napnkegaikfleylvspeaqkifsegnneypvvagvpiasvlkpfgsfkndstnvsvyg
    klnadaiklmdrvgwkle