PDB entry 6g6y

View 6g6y on RCSB PDB site
Description: Eg5-inhibitor complex
Class: cell cycle
Keywords: Eg5, Kif11, Eg5-inhibitor, CELL CYCLE
Deposited on 2018-04-03, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11, EG5, KNSL1, TRIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g6ya_
  • Heterogens: ADP, MG, EOK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g6yA (A:)
    gpmasqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggla
    dkssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmege
    rspneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdv
    serlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsv
    fsvtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrv
    italvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahrakn
    ilnkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g6yA (A:)
    kniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtgssrktytfdmvfgastkqidv
    yrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiiprtlh
    qifekltdngtefsvkvslleiyneelfdllnpserlqmfddprnkrgviikgleeitvh
    nkdevyqilekgaakrttaatlmnayssrshsvfsvtihmketelvkigklnlvdlagse
    nninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsiiatispaslnlee
    tlstleyahraknilnkpe