PDB entry 6g4q

View 6g4q on RCSB PDB site
Description: Structure of human ADP-forming succinyl-CoA ligase complex SUCLG1-SUCLA2
Class: ligase
Keywords: Complex, Succinyl-CoA Ligase, Mitochondrial, ATP-specific, Ligase
Deposited on 2018-03-28, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SUCLG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53597 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d6g4qa1, d6g4qa2, d6g4qa3
  • Chain 'B':
    Compound: Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SUCLA2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NEP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g4qA (A:)
    smsytasrqhlyvdkntkiicqgftgkqgtfhsqqaleygtklvggttpgkggqthlglp
    vfntvkeakeqtgatasviyvpppfaaaaineaieaeiplvvcitegipqqdmvrvkhkl
    lrqektrligpncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglg
    qslcvgiggdpfngtdfidcleiflndsategiiligeiggnaeenaaeflkqhnsgpns
    kpvvsfiagltappgrrmghagaiiaggkggakekisalqsagvvvsmspaqlgttiyke
    fekrkml
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g4qA (A:)
    msytasrqhlyvdkntkiicqgftgkqgtfhsqqaleygtklvggttpgkggqthlglpv
    fntvkeakeqtgatasviyvpppfaaaaineaieaeiplvvcitegipqqdmvrvkhkll
    rqektrligpncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgq
    slcvgiggdpfngtdfidcleiflndsategiiligeiggnaeenaaeflkqhnsgpnsk
    pvvsfiagltappgrrmghagaiiaggkggakekisalqsagvvvsmspaqlgttiykef
    ekrkm
    

  • Chain 'B':
    No sequence available.