PDB entry 6g46

View 6g46 on RCSB PDB site
Description: Red kidney bean purple acid phosphatase in complex with 2-(Naphthalen-1-yl)thiazole-4-carboxylic acid
Class: metal binding protein
Keywords: Phosphatase, Metallohydrolase, Hydrolase, Metalloprotein, purple acid phosphatase, PAP, red kidney bean, rkbPAP, drug design, drug discovery, rational drug design, osteoporosis, METAL BINDING PROTEIN
Deposited on 2018-03-26, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fe(3+)-Zn(2+) purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g46a1, d6g46a2
  • Chain 'B':
    Compound: Fe(3+)-Zn(2+) purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g46b1, d6g46b2
  • Chain 'C':
    Compound: Fe(3+)-Zn(2+) purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g46c1, d6g46c2
  • Chain 'D':
    Compound: Fe(3+)-Zn(2+) purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g46d1, d6g46d2
  • Heterogens: ZN, FE, SO4, NAG, FUC, ELH, EDO, NA, IPA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g46A (A:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvddst
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g46A (A:)
    nrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrk
    riakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvp
    ytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfte
    rsvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahi
    ivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkf
    eawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnygv
    idsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwyp
    vdds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g46B (B:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvddst
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g46B (B:)
    nrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrk
    riakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvp
    ytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfte
    rsvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahi
    ivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkf
    eawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnygv
    idsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwyp
    vddst
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6g46C (C:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvddst
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g46C (C:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvdd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6g46D (D:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvddst
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g46D (D:)
    nrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrk
    riakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvp
    ytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfte
    rsvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahi
    ivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkf
    eawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnygv
    idsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwyp
    vdd